KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0036Help
Entry
Rsph17029_0036    CDS       T00484                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rsph17029_0036
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Rsph17029_0036
    3.5.1.-  
     Rsph17029_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(45243..45848)
Genome map
AA seq 201 aa AA seqDB search
MRPQTEALIVIDVQNDFCPGGALAVAGGDAIIPRINALLPEFGARIFTQDWHPADHSSFA
STHEAVPFSLIEMPYGPQVLWPTHCVQGTRGAEFHPALETAPADLVLRKGFRRGIDSYSA
FFENDRTTPTGLEGYLRSRGIEAVTLAGLATDFCVAYSALDAARLGFRVTVLEGASAAID
LNGSLAAIKAQMAEAGVALEP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccagaccgaagccctgatcgtcatcgacgtgcagaacgacttctgcccgggc
ggcgcgctcgccgtcgccggaggggacgcgatcatcccccggatcaacgcgctcctgccc
gagttcggcgcgcgcatcttcacgcaggactggcatccggccgaccattcctccttcgct
tccacccacgaggcggtgcctttctcgctgatcgagatgccctacgggccgcaggtgctc
tggcccacccattgcgtgcagggcacgcgcggcgccgagttccatcccgcgctcgagacg
gcgccggccgatctcgtcctccgcaagggcttccgccgcgggatcgacagctactcggcc
ttcttcgagaacgaccgcaccacccccaccggcctcgagggctacctgcgcagccgcggg
atcgaggcggtgacgctcgcgggcctcgccaccgacttctgcgtggcctattccgctctc
gacgcggcccggctgggcttccgggtgacggtgctggaaggcgcctcggccgccatcgac
ctcaacggatcgctcgccgcgatcaaggcgcagatggccgaggccggcgtcgcgctggag
ccctga

DBGET integrated database retrieval system