KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0165Help
Entry
Rsph17029_0165    CDS       T00484                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rsh00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rsh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:179840..181045
Genome map
AA seq 401 aa AA seqDB search
MSAYLKSHPTHDGFFGPYGGAMLPPPLEPHFAAIREAYGRISKSADFIAELRYIRKHFQG
RPTPVSHLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLAQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLEMTGELPDMVAACVGG
GSNAMGIFSGFLDDEVALYGIEPCGTSSKLGDHAATIAYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDREALAAFFALSRHEGIIPALESAHA
VAFAMREAKAHPGKSILVNLSGRGDKDIDYVTQTFGFGETA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatctgaaatcccacccgacccacgacggcttcttcggcccctacggaggc
gccatgctgccgcctccgctcgagccccatttcgccgccatccgcgaggcctatggccgg
atctcgaaatcggccgatttcatcgccgagctgcgctacatccgcaagcatttccagggc
cggcccacgccggtctcccacctgaagaacctctcggcgctctgcggcggcgcccagatc
tatgccaagcgcgaggatctgaaccacaccggcgcgcacaagctgaaccactgcatggcc
gaggggctgctcgcccgcttcatgggcaagaccaagctgatggccgagaccggcgcgggc
cagcacggcgtggccctggccacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacgcgcatgaagctgctgggc
gccacggtggtgccggtgggcttcggcggccgctcgctgaaggaggcggtcgacagctgc
ttccagagctacctcgcccaggccgacacggcgctcttcgcgatcggctcggtcgtgggg
ccgcatccgttcccgatgatggtgcgcgacttccagcatgtggtgggggtcgaggcgcgc
gagcagttcctcgaaatgacgggcgagctgcccgacatggtggcggcctgcgtcggcggc
ggatcgaatgcgatggggatcttctcgggcttcctcgacgacgaggtggcgctctacggg
atcgagccctgcggcacctcctcgaagctcggcgaccatgcggcgacgatcgcctacggc
gaagacggcgacatccacggcttccgcaccatggtgctgaaggatgccgagggcaatccg
gcgccggtccataccgtggcctccggcctcgactacccgggcgtcggccccgaacatgcc
ttcctgcaccgttccgggcgcgtgacctataccggcgccgacgaccgcgaggcgctcgcg
gccttcttcgccctctcgcgccacgagggcatcatccccgccctcgaaagcgcccatgcc
gtggccttcgccatgcgcgaggcgaaggcccatccgggcaagtcgatcctcgtcaacctc
tcggggcgcggcgacaaggacatcgactacgtcacccagaccttcggcttcggcgagacc
gcctga

DBGET integrated database retrieval system