KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0248Help
Entry
Rsph17029_0248    CDS       T00484                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rsph17029_0248 (deoA)
Enzymes [BR:rsh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rsph17029_0248 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:269909..271216
Genome map
AA seq 435 aa AA seqDB search
MDARSINAKLRRGEVPSAAELGWFAEGLASGHVTDAQAGAFAMAVCLQGLGEEGRVALTR
AMRDSGRVLAWDLPGPVLDKHSTGGIGDCTSLLLAPALAACGAYVPMISGRGLGHTGGTL
DKLEAIPGFRVALGEERLRAQIEDVRCAIVAADEGMAPADRRLYLIRDVTGTVESIDLIT
ASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEAEALARALVGTAQGAGCMTSALITDMSQ
PLATAAGNALEVIEVMETLTGTSINAALWDVTVALGGEALALGGLAADAEDGAHRIEQAL
ESGHAAEFFARMVAAQGGPVDFVERWPDRLPSAPVMREVPSLRTGFVLRIDTAALGQAVV
HLGGGRLRETDRVNPSVGLADIAGIGEEVSEDLPLAMIHAATEADADAAVAAIQAAYVIS
DQEPAEPPLIHARIA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcgcgatcgatcaacgcaaagctgcgccggggcgaagtgccctcggccgctgaa
ctgggctggttcgcggaaggtctggcctcgggccatgtcaccgatgcgcaggccggcgcc
ttcgccatggcggtctgcctgcaggggctgggcgaggaggggcgtgtggccctgacgcgc
gccatgcgcgactccggccgtgtgctcgcctgggatctgccggggccggtgctcgacaaa
cattcgacgggcggcatcggcgactgcacctcgctgctcctcgcgccggctctggctgcc
tgcggggcctatgtgccgatgatctcgggtcggggcctcggccatacggggggcacgctc
gacaagctggaagcgatcccgggcttccgcgtggccctgggcgaagagcggctgcgcgcg
cagatcgaggatgtccgctgcgccatcgtcgccgccgacgagggcatggcgcccgcggac
cggcggctctacctcatccgcgacgtgaccggcacggtcgaatcgatcgacctcatcacc
gcgtcgatcctgtcgaagaagctggcggccggcctcgaggggctggtgctcgatgtgaaa
gtgggctcgggcgccttcatgaagtcgatggacgaggccgaagcgctggcgcgtgctctg
gtgggcacggcgcagggggcgggctgcatgacatcggccctcatcaccgacatgagccag
ccgctcgcgaccgcggccggcaatgcgctcgaggtgatcgaggtgatggagacgctgacc
ggcacctcgatcaacgcggcactctgggacgtgacggtggcgctcggcggtgaggctctg
gcgctgggcgggcttgccgccgacgccgaggacggggcgcaccggatcgagcaggcgctg
gaaagcgggcacgcggccgagttcttcgcccgcatggtggcggcgcagggcgggccggtc
gatttcgtcgaacgctggcccgaccggctgccctcggccccggtgatgcgcgaggtgccg
agcctgcgcacgggcttcgtgctgcgcatcgacacggcggcgctcggtcaggcggtggtg
catctgggcggcgggcggctgcgcgagaccgaccgggtgaatccctcggtgggtctggct
gatatcgccgggatcggcgaagaagtgtccgaggatctgccgctcgccatgatccatgcc
gcgaccgaggccgatgccgatgctgcggtggccgcgattcaggcggcctatgtgatctcg
gatcaggagccggccgaaccgccgctcatccatgcgaggatcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system