KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0301Help
Entry
Rsph17029_0301    CDS       T00484                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rsph17029_0301
Enzymes [BR:rsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rsph17029_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:318459..318995
Genome map
AA seq 178 aa AA seqDB search
MPSAGRFPEGNVSEAISAVASAFQAPFRVSRLFKTPFFPAGAAPDFVNAAMALHLTDDVD
PRKILAQLHEIEADFGRSRSHRWADRTLDLDLIALDDSVRPDADTQERWRHLPPEEQARR
TPDGLILPHPRLQDRAFVLVPLADVAPEWRHPLLGLTVREMLAALPEAERAAAVPLGA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgcgggaaggttcccggagggcaacgtttccgaggcgatttctgcggttgcg
agcgcatttcaagccccatttcgggtgagcaggctgttcaaaacgcccttttttcccgcg
ggcgcagcccctgattttgtcaatgcggccatggctctgcaccttacggatgatgtcgat
ccccgcaagatcctcgcacagctgcacgagatcgaggcggattttggccgatcccggtcg
cacagatgggccgaccggacgctcgacctcgatctcatcgccctggatgattcggtccgg
cccgacgccgacacccaggagcggtggaggcaccttcctcccgaggagcaggcccgccgc
acgccggacgggctcatattgccgcacccccggcttcaggaccgggccttcgtgctcgtc
ccgctggccgacgtggcgcccgagtggcgtcatccgctgctcggcctgacggtcagagag
atgcttgcggcgctgcctgaggcggagcgggccgccgctgtgccgctcggggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system