KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0472Help
Entry
Rsph17029_0472    CDS       T00484                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rsph17029_0472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17029_0472
  Lipid metabolism
   00071 Fatty acid degradation
    Rsph17029_0472
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rsph17029_0472
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rsph17029_0472
   00626 Naphthalene degradation
    Rsph17029_0472
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rsph17029_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:492993..494117
Genome map
AA seq 374 aa AA seqDB search
MKITAAVLERDGIAGNYAEERPLAIRELDLAEPGPGEVLIRVAAAGICHSDLSVINGTRR
RPLPMVLGHEASGHVEALGEGVEDLEPGDHVVCIFAPGCGRCTPCAEGRPALCEKAARHH
AVGELMTGHRRLSLGGRSVHHHLGISGFATHAVVARPSLVRVPREVPPHVSALFSCAMLT
GAGAVFNTAQIRPGSKVAVVGLGGVGLSAILGAAAAGAAEIVAIDPFPAKMEAARAMGAT
LSVPADGDTVAAVRDLTAGGVDYAFELAGSVRALETAFAVTRRGGMTVTAGLPHPDDRMS
LEALKLVAEERTLKGSYIGSCVPQRDLPRMLALHRRGLLPVEKMLTHRLKLDEINLAMDR
LAEGSAIRQVVDLG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacggcggcggtgctcgaacgcgacgggatcgcggggaattatgccgaggag
cggccgctcgcgatccgcgagctcgatctcgcggagccggggccgggcgaggtcctgatc
cgggtggccgccgcgggcatctgccattccgacctgtcggtcatcaacggcacgcggcgg
cggccgctgccgatggtgctcggccacgaggcctcgggccatgtcgaggctctgggcgag
ggggtcgaggatcttgagcccggcgaccatgtcgtctgcatcttcgcacccggctgcggc
cgctgcacgccctgcgccgaggggcggcctgcgctctgcgagaaggcggcgcgccatcat
gcggtgggcgaactgatgaccgggcaccggcggctgtcgctcggcgggcggtccgtgcac
catcacctcggcatctcgggctttgccacccatgccgtggtggcgcggccgtcgctggtc
cgcgtcccgcgcgaggtcccgccccatgtctcggcgcttttctcctgcgccatgctgacg
ggggcgggggccgtcttcaacacggcgcagatccggcccggctcgaaggtcgccgtggtg
gggctgggcggcgtcggcctgtccgccatcctcggcgcggcggcggccggagcggccgag
atcgtggcgatcgacccgtttcccgccaagatggaggccgcgcgcgccatgggcgcgacg
ctctcggtgcccgcggacggagatacggtggcggcggtgcgcgacctgacggcgggcggc
gtcgattacgccttcgagctggcgggctcggtccgggcgctcgaaaccgccttcgccgtc
acccgccgcggcggcatgacggtgaccgcgggcctgccccacccggacgaccggatgtcg
ctcgaggcactgaagctcgtggccgaggagcgcaccctgaaaggcagctacatcggatcc
tgcgtgccccagcgcgacctgccgcggatgctggcgctgcaccgccgcggcctgctgccg
gtcgagaagatgctgacccaccggctgaagctcgacgagatcaacctcgcgatggaccgg
ctggccgagggcagcgcgatccggcaggtggtggatctcggctga

DBGET integrated database retrieval system