KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0480Help
Entry
Rsph17029_0480    CDS       T00484                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17029_0480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17029_0480
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rsph17029_0480
Enzymes [BR:rsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rsph17029_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:500110..501495
Genome map
AA seq 461 aa AA seqDB search
MQYISTRGTAPVLGFGEAMLTGLARDGGLYVPETVPALSESEIAALAGLSYEEVAFRIMR
PFVGETFGDDEFRGLIAAAYEGFGHAARAPLVQLGPNHFLLELFHGPTLAFKDFAMQLIG
QLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNVDVFILFPHGRVSEVQRRQMTTP
SEANVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSINWARVLAQVVYYFTSAVA
LGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARLVVATNQNDILHRALSTGAYETEGV
TPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMAELKQGGFRISENALGTLRATFASG
RASEEETLATIRATHAATGELLCPHSAVGVKVAEEALGPEPMITLATAHPAKFPDAVEAA
TGLRPPLPARMADLFDRPERVTRVPNDLSALETLIRERTGR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatctcgactcgcggcacggctccggttctcggcttcggcgaggccatgctg
acgggccttgcccgggacggcggtctctatgtgcccgagacggtgcccgccctgtcggag
tccgagatcgcggcgctggcgggcctgtcctacgaggaggtggccttccgcatcatgcgg
cccttcgtgggcgagaccttcggggacgacgagttccgcggcctgatcgccgccgcctac
gagggcttcggccatgccgcccgcgcgccgctggtgcagctcggcccgaaccacttcctg
ctcgagctgttccacgggcccacgctcgccttcaaggacttcgccatgcagctgatcggc
cagctgttccaggcggcgctggcgaagaacgggcaacggatcaccatcgtcggcgccaca
tcgggcgacaccggctcggccgcgatcgaggccttccgcggcctctcgaacgtcgatgtc
ttcatcctcttcccgcacggccgcgtgtccgaggtgcagcgccgccagatgacgacgccg
tccgaggcgaacgtccatgccctcgcggtggacggcgacttcgacgattgccaggcccgg
ctgaaggacatgttcaacgacttcgccttccgcgatgcggtggggctggcgggcgtcaat
tcgatcaactgggcgcgggtgctggcgcaggtcgtctattacttcacctcggcggtggcg
ctcggcgcgccgcaccgcgaggtgagcttcacggtgcccaccggcaatttcggcgacatc
ttcgcgggctacatcgcgcggcgcatggggctgcccatcgcccgcctcgtggtggccacc
aaccagaacgacatcctgcaccgcgcgctctcgaccggagcctacgagaccgagggggtc
acgccgtcgatcagcccctcgatggacattcaggtctcctcgaacttcgagcgggccttg
ttcgatgcctatggccgcgacggggcggcggtggcggccctcatggccgagctgaagcag
ggcggcttccgcatctccgagaatgcgctggggacgctgcgcgcgaccttcgcctcgggc
cgtgcctccgaggaggagacgctggccacgatccgcgccacccatgcggcgacgggcgag
cttctctgcccccattcggccgtgggcgtgaaggtggccgaggaggcgctcggccccgag
ccgatgatcacgctcgccaccgcccatccggccaagttccccgatgcggtcgaggcggcc
actggcctgcgcccgccgctgcctgcccgcatggccgatctcttcgaccgccccgagcgg
gtgacgcgcgttcccaacgacctgtccgccctcgaaaccctcatccgcgaaaggaccggg
cgttga

DBGET integrated database retrieval system