KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0511Help
Entry
Rsph17029_0511    CDS       T00484                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rsph17029_0511
Enzymes [BR:rsh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rsph17029_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:538119..539156
Genome map
AA seq 345 aa AA seqDB search
MIYVRPIPLADAARPEGALPLAGGPLFFDRVEILERGRAPALLPAAELDPATLAPLTAPR
PPVAGLAMDRPQIMGILNVTPDSFSDGGRFAALPEALAQAEALVAAGADILDIGGESTRP
GAAEVEPAEEIRRTAPVIERLRGQGIAVPVSIDTRKAPVAEAALIAGADLVNDVAALTWD
AGLAAVAARREAPVCLMHAQGTPQTMQADPRYDDVLLDVYDWLAERIRAAEAAGIPRARI
VTDPGIGFGKTLEHNLALLRRLSLFHGLGCPILLGASRKRFIGTLAAEPSADRRMAGSVA
VALAGAAQGAQILRVHDVRETRQALILWQAVTREAAETAAERRQA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgtccgtccgatcccgctcgccgatgcggcccgccccgagggcgcgctgccg
ctcgccggcggtccgctgttcttcgaccgcgtcgagatcctcgaacgcggacgcgcacct
gccctgctgcccgcagccgagctcgatccggccacactcgcccccctgacggcgccgcgg
cccccggtggcggggctcgccatggaccggccgcagatcatgggcatcctcaacgtgacg
cccgacagtttctcggacggcggccggttcgcggcgctgcccgaggcgctggcgcaggcc
gaggcgctggtggcggcgggcgccgacatcctcgacatcggcggcgagagcacgcggccc
ggtgcggcggaggtggagccggccgaggagatccgccgcaccgcgccggtgatcgagagg
ctgcgcgggcaggggatcgccgtgccggtctcgatcgacacccgcaaggccccggtggcc
gaggccgcgctgatcgcgggggccgatctcgtgaacgatgtggcggccctgacctgggac
gcggggctggccgccgtggcggcgcggcgggaggcgccggtctgcctgatgcatgcgcag
ggtacgccgcagaccatgcaggccgacccgcgctacgacgacgtgctgctcgatgtctac
gactggctggccgaacgcatccgggcggccgaggcggctggcatcccgcgggcccggatc
gtgaccgacccgggcatcggcttcggcaagacgctcgagcacaatctggcgctgctgcgc
cggctgtcgctctttcacgggctgggctgcccgatcctgctcggcgcctcgcgcaagcgt
ttcatcggcacgctggccgccgagccttcggccgaccggcgcatggcgggctcggtcgcc
gtcgcgcttgcgggcgcggcgcaaggagcgcagattctcagagtgcacgacgtgcgcgag
acacgtcaggcgctgatcctgtggcaggcagtcacacgcgaggcggcagagaccgcggca
gaacggaggcaggcatga

DBGET integrated database retrieval system