KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0598Help
Entry
Rsph17029_0598    CDS       T00484                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17029_0598
   01230 Biosynthesis of amino acids
    Rsph17029_0598
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17029_0598
   00051 Fructose and mannose metabolism
    Rsph17029_0598
   00562 Inositol phosphate metabolism
    Rsph17029_0598
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17029_0598
Enzymes [BR:rsh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rsph17029_0598
Exosome [BR:rsh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rsph17029_0598
  Exosomal proteins of bladder cancer cells
   Rsph17029_0598
  Exosomal proteins of melanoma cells
   Rsph17029_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(622811..623548)
Genome map
AA seq 245 aa AA seqDB search
MRKLAAGNWKMNGTEADLGEIDALLAAHPAPRCEMLICPPATLVARMAGRAAQGLMVGGQ
DCHPKTSGAHTGDVSAAMLADAGASHVILGHSERRADHGETDSLVRLKAEAAWGAGLVAI
VCVGETEAQRDAGQTLDVIGAQLAGSVPEAATAANTVIAYEPVWAIGTGRTPTTAEIAEV
HAFLRARLAERFSDAEGFRLLYGGSVKPSNAAEIFAVPNVDGALVGGASLKAADFGGIVE
ALSAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacttgcggccggaaactggaagatgaacggaaccgaggcggatctgggcgag
atcgacgccctgcttgccgcgcatccggcgccccgctgcgagatgctgatctgtccgccc
gcaacgcttgttgcgcgcatggcgggacgcgcggcgcagggcctgatggtcggcgggcag
gactgccaccccaagacctccggcgcccataccggcgacgtctcggccgccatgctcgcc
gatgccggggcgagccacgtcattctcggccattccgaacgccgcgccgatcatggcgag
acggactcgctcgtgcggctgaaggccgaagcggcctggggcgcgggccttgtcgccatc
gtctgcgtgggcgaaaccgaggcccagcgcgacgcgggccagacgctcgacgtgatcggg
gcacagcttgcgggctcggtgccggaagccgccaccgcggccaacaccgtgatcgcctac
gagccggtctgggccatcggcaccggccgcacgcccacgaccgccgagatcgccgaggtt
cacgccttcctccgcgcgcggctcgccgagcggttttcggatgcggagggcttccgactg
ctctacggcggctcggtgaagccgtcgaatgcggccgagatcttcgccgtgccgaatgtc
gatggcgcgctggtcggcggcgcgagcctcaaggccgcggatttcggcgggatcgtggag
gccctttcggccgcctga

DBGET integrated database retrieval system