KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1025Help
Entry
Rsph17029_1025    CDS       T00484                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rsph17029_1025
Enzymes [BR:rsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Rsph17029_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1057846..1058502
Genome map
AA seq 218 aa AA seqDB search
MNEMSDLSDLAKREEIIRQCLEMNRSGLNQGTSGNISVRHGEGMLITPTSLPYDTLVPED
IVFVSMEGEVRGRHKPSSEWRFHRDILRERADVNAVVHAHPTYCTTLAIMNREIPSIHYM
LAVVGGPNIRCAPYAIYGSEELSRNAVEALRDRKACLLEHHGMIAVGKSLAQAMWLAVEV
ETLARQYHGCLQIGEPRLLSERQIQDVIDKIAGYGHQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgagcgatctgtccgacctcgccaagcgcgaagagatcatccgccagtgt
ctcgagatgaaccgctcgggcctcaatcagggcacctcgggcaacatctcggtgcgccac
ggcgaggggatgctgatcacccccacgtcgctgccctacgacacgctggttcccgaggac
atcgtcttcgtctcgatggagggcgaggtgcggggccggcacaagccgtcgagcgaatgg
cgcttccaccgcgacatcctgcgcgagcgggcggacgtgaatgcggtggtgcatgcgcat
ccgacctactgcaccacgctcgccatcatgaaccgcgagatcccctcgatccactacatg
ctggcggtggtgggcggcccgaacatccgctgcgcgccctacgcgatctacggttcggag
gagctgtcgcggaacgcggtcgaggcgctgcgcgaccgcaaggcctgccttctcgaacat
cacggcatgatcgccgtgggcaagagcctcgcgcaggccatgtggctcgccgtcgaggtc
gagacgctggcccggcagtatcacggctgccttcagatcggcgagccgcggctgctgagc
gagcggcagatccaggacgtgatcgacaagatcgccggctacggccaccagggctga

DBGET integrated database retrieval system