KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1053Help
Entry
Rsph17029_1053    CDS       T00484                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rsph17029_1053
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rsph17029_1053
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rsph17029_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1084864..1085394
Genome map
AA seq 176 aa AA seqDB search
MTVRPHLALAFACLAAPALAAGPPPVTFDSIDGGQIRLDELRTAGPVLVVNTASLCGFTP
QYDDLQALWDRYRDAGLTVLAVPSNDFKQELDDAGAVRDFCATNFDLTLPMTTITPVTGV
EAHPFYRWLAQEHGVEPRWNFHKVLIDRDGDLVASWSSPVRPTDREIVGRIEALLP
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccgtccgcaccttgcgctcgcctttgcctgtctcgccgcgcccgccctcgcc
gcgggaccgccgccggtcaccttcgactcgatcgacggcgggcagatccgcctcgacgag
ctgcgcacggcaggcccggtgctggtggtgaacacggcctcgctctgcggcttcaccccg
caatacgacgatcttcaggcgctctgggatcgctaccgcgacgcggggctgacggtcctc
gccgttccgtcgaacgatttcaagcaggagctggacgatgcgggcgcggtgcgcgacttc
tgcgccaccaacttcgacctgacgctgcccatgaccaccatcactccggtgacgggggtc
gaggcccatcccttctaccgctggctcgcgcaggagcatggggtcgagccccgctggaac
ttccacaaggtgttgatcgaccgtgacggggatctggtggcgagctggtcctcgccggtg
cggccgacggaccgcgagatcgtgggccggatcgaggcgctcctgccgtga

DBGET integrated database retrieval system