KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1058Help
Entry
Rsph17029_1058    CDS       T00484                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rsph17029_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1089337..1090380
Genome map
AA seq 347 aa AA seqDB search
MRLTLTVLIATTALAGAAQADALRDKALGYFAPLPSTVPAVKDNRITPEKIELGKALFFD
PRLSASGVFSCYSCHNLTTGGGDNLETSIGHGWQKGPRNAPTVLNAVLNEAQFWDGRADD
LKAQAKGPVQAGVEMANTPGQVEVTLKSLPQYVDWFAAAFPGEPEPTSFDNMAKAIEAFE
ATLITPAPFDAFLNGDDAALTEDQRAGLDLFIDKGCSTCHSGVNVGGHGYYPFGLIEKPG
ADILPEGDKGRFAVTATVDDEYVFRAAPLRNVAVTAPYFHSGKVWDLKTAVTIMAESQLG
ETMSDQEVGQVVAFLESLTGTMPPVTLPVLPAETAGTPRPTAEIRVE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgaccctcaccgtcctgatcgcgacgacggccctcgccggcgcggctcaggcc
gacgccctccgggacaaggctctgggatattttgccccgctgccctcgacggttccggcc
gtgaaggacaaccgcatcaccccggagaagatcgagctcggcaaggcgctcttcttcgat
ccgcgtctgtcggcctcgggcgtcttctcctgctattcctgccacaacctcacgacgggc
ggcggcgacaacctcgagacctcgatcggccacggctggcagaaggggccgcggaacgcg
cccaccgtgctcaatgcggtgctgaacgaggcgcagttctgggacgggcgggccgacgac
ctgaaggcgcaggccaaggggccggtgcaggcgggcgtcgagatggcgaacacgcccggg
caggtcgaggtgacgctgaaatccctgccgcaatatgtcgactggttcgccgccgccttc
ccgggcgagccggagcccaccagcttcgacaacatggccaaggccatcgaggccttcgag
gcgacgctcatcacgcctgcgcccttcgacgccttcctgaacggagacgatgcggccctg
accgaggatcagcgggcgggcctcgatctcttcatcgacaagggctgctcgacctgccac
tcgggcgtgaacgtgggcgggcacggctactatccgttcggcctgatcgagaagcccggc
gcggacatcctgcccgagggcgacaagggccgtttcgcggtgacggccacggtggacgac
gaatatgtcttccgggcggcgccgctgcgcaacgtggcggtcacggcgccctatttccac
tcgggcaaggtgtgggacctgaagaccgccgtcacgatcatggccgagagccagctcggc
gagacgatgagcgatcaggaggtggggcaggtcgtggccttcctcgagagcctcacgggg
accatgccgccggtcacgctgccggtgctgcctgccgagacggcaggcacgccgcgcccc
acggccgagatccgggtcgagtga

DBGET integrated database retrieval system