KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1082Help
Entry
Rsph17029_1082    CDS       T00484                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rsph17029_1082
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rsph17029_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1117324..1118277)
Genome map
AA seq 317 aa AA seqDB search
MSGAPFHAALARGPARAHADWIRTGDGVRLRTVVWPEGAAGTVLIFSGRTEYAEKYGPAA
EALRRRGFASATLDWRGQGLSDRSLRDPLVGHVDDFASYQQDVTAFVAALRAQGLPEPFH
LLAHSMGGCIGLRALHEGLPVRAACFSAPMWGIRVHAALRIVAAALGALARATGLGHRYV
PGTGTRSYVATAAFDTNVLTRDPEMFAWMQEQLVQAPELGLAGPSLDWLRAAFEETARLK
RLPAPDLPALCIVGSAEKVVDLEEIQRRMEGWGRGELQIVPGAEHEVMMDRPEVRDAFFD
AAAALFRMNAGPDAVRS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggcgcaccttttcacgccgcgcttgcgcgtggcccggcgcgggcacacgccgac
tggatccgcaccggcgacggtgtgcggctgcgcaccgtggtctggcccgagggggcggcg
ggaaccgtcctcatcttctcgggccgcaccgaatatgccgagaaatacggccccgcggcc
gaggcgctgcgccggcgcggctttgcctcggccaccctcgactggcgcggacaggggctg
tcggaccggtcgctccgcgatccgctcgtgggccatgtcgacgatttcgcctcctatcag
caggatgtgacggccttcgtcgcggccctgcgcgcgcagggactgcccgagcccttccat
cttctggcccactccatgggcggctgcatcgggctccgcgcgctgcacgaggggctgccc
gtgcgcgccgcctgcttctcggcgccgatgtggggcatccgcgtccatgccgcgctgcgg
atcgtagcggcggcactcggggcgctcgcccgcgcgacggggctcggccaccgctatgtc
cccggcaccgggacccgcagctatgtggccaccgccgccttcgacacgaacgtcctcacc
cgcgaccccgagatgttcgcctggatgcaggagcagctggtgcaggcgccggaactcggt
cttgccggcccgagcctcgactggctgcgcgcggccttcgaggagacggcgcggctgaag
cggctgcccgcgccggatctgcccgcgctctgcatcgtgggctcggccgagaaggtcgtc
gatctcgaggagatccagcgccggatggagggctggggtcggggcgaactgcagatcgtg
cccggggccgagcatgaggtgatgatggaccgccccgaggtgcgcgacgccttcttcgac
gccgccgcggcgctgttccggatgaacgccggccccgacgccgtcagatcctga

DBGET integrated database retrieval system