KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1111Help
Entry
Rsph17029_1111    CDS       T00484                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rsph17029_1111
Enzymes [BR:rsh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rsph17029_1111
Exosome [BR:rsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17029_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1150915..1153101
Genome map
AA seq 728 aa AA seqDB search
MNVTSKPGELVPESDVAAIMRGTHGDPFRVLGMHGGGGAPLSVRVFAPQAAEVAVLGQGG
KVLASLERIGAEGFFAGTVPGEEKFPYRLRFVSGPHEWEADDPYRFPEVLGELDEYLLGE
GRHYQLYTRLGAHPAEIEGVQGVSFAVWAPNARRVSVVGAFNAWDGRRHPMRKRIGVGVW
ELFVPGLHTGDLYKYEILGPSGERLPLKSDPLSFAQEAPPATASVVHGLPEAEWHDAGWM
QERESRQRRDAPISIYEVHAGSWRQGLDYDALAEELSAYVREMGFTHVEFLPISEHPFTG
SWGYQPIGLFAPTARFGPPEGFARLVDRLHRDGIGVILDWVPAHFPSDAHGLANFDGTHL
YDHADPRQGFHRDWNTQIYNFGRQEVANFLQASALFWLDRYHVDALRVDAVASMLYLDYS
RNAGEWVPNRHGGRENLEAIDFLRGVNERVRLDHPGCITIAEESTAFPQVSRPVEDGGLG
FGFKWNMGWMHDTLGYFRRDPIHRKHHQNDLTFGMVYAYSEDFVLPLSHDEVVHGKGSLI
GQMAGDRWQKFANLRAYFGFMWAHPGKKLLFMGGEFAQEREWNHDASLDWHLLDDPSHAG
MKRLVADLNREYRKRPALHRMDCDPEGFEWIDAGDSENSVLSFLRKAPGEKPVLAVCNLT
PVVRSDYRIGVPEGGEWREILNSDAAIYGGSDVGNPGGLQAEEVSWHGRPASLRLTLPPL
ATIFVTPA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgacatcgaagcccggggagctcgtccccgaaagcgacgtggccgccatcatg
cgcggaacgcacggagatcccttccgcgtgctgggcatgcacggaggcggcggcgcgccg
ctctccgtccgggtcttcgccccgcaggccgcggaggttgcggtgctggggcaggggggc
aaggtgctcgcctctctcgaacgcatcggcgccgagggcttcttcgccggcacggtgccg
ggcgaggagaaattcccctaccgcctccgcttcgtctcggggccgcacgagtgggaggcg
gacgatccctaccgcttccccgaggtgctgggcgagctcgacgaatatcttctgggcgag
gggcggcactatcagctttatacccggctcggcgcgcatccggccgagatcgagggcgtg
caaggcgtgagcttcgccgtatgggcgccgaacgcccgccgcgtctcggtcgtgggcgcc
ttcaacgcctgggacggccgccgccacccgatgcgcaagcgcatcggcgtgggcgtgtgg
gagctgttcgttcccggccttcatacaggcgatctctacaaatacgagatcctcgggcct
tcgggcgagcggttgccgctcaagtccgacccgctctcctttgcgcaagaggcgccgccg
gccacggcttcggtggtccatgggctgcccgaggccgagtggcacgatgcgggctggatg
caggagcgcgagagccgccagcgccgcgacgcgccgatctcgatctacgaggtccatgcg
ggctcgtggcggcaggggctcgattacgacgcgctggccgaggaactgtcggcctatgtg
cgcgagatgggcttcacccatgtggagttcctgccgatcagcgaacatcccttcaccggc
tcttggggctatcagcccatcggcctcttcgcccccaccgcgcgcttcggcccgcccgag
ggcttcgcgcggctggtggaccggctccaccgcgacgggatcggcgtcatcctcgactgg
gtgccggcgcacttcccgtcggacgctcatgggctggccaatttcgacgggacccatctc
tatgaccatgccgacccgcggcagggcttccaccgcgactggaacacccagatctacaac
ttcggccggcaggaggtggcgaacttcctgcaggcctcggcgctcttctggctcgaccgc
taccatgtcgatgcgctgcgcgtggatgcggtggcctcgatgctctacctcgactattcg
cggaacgccggcgaatgggtgccgaaccgccacggcgggcgcgagaatctcgaggcgatc
gatttcctgcgcggcgtgaacgagcgcgtccggctcgaccatccgggctgcatcaccatc
gccgaggaatcgacggccttcccgcaggtgagccgcccggtcgaggacggcgggcttggc
ttcggcttcaagtggaacatgggctggatgcacgacacgctgggctatttccggcgcgac
ccgatccaccgcaagcaccaccagaacgacctgaccttcggcatggtctatgcctattcc
gaggatttcgtcctgcccctcagccatgacgaggtggtgcacggcaagggctcgctcatc
gggcagatggcgggcgaccgctggcagaagttcgcgaaccttagggcctatttcggcttc
atgtgggcccatccgggcaagaagctcctcttcatgggcggcgagttcgcgcaggagcgc
gagtggaaccacgatgcctcgctcgactggcacctgctcgacgatccgtcccacgccggg
atgaagcgcctcgtggccgacctgaaccgcgaatatcgcaagcgccccgcgctgcaccgg
atggattgcgatcccgaaggtttcgagtggatcgacgccggcgacagcgagaacagcgtg
ctgagcttcctgcgcaaggcgcccggcgaaaagccggtgctggcggtctgcaacctcacg
ccggtggtgcggtcggattaccggatcggggtgcccgagggcggcgagtggcgcgagatc
ctcaactccgacgccgcgatctacggcggctcggatgtgggcaatcccggcgggcttcag
gccgaggaagtcagctggcacggacgtccggcctcgctgcgcctgacgctgccgccgctt
gcgacgatcttcgtgacgcctgcatga

DBGET integrated database retrieval system