KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1111Help
Entry
Rsph17029_1111    CDS       T00484                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00500  Starch and sucrose metabolism
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
Module
rsh_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rsph17029_1111
Enzymes [BR:rsh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rsph17029_1111
Exosome [BR:rsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17029_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ABN76221
JGI: Rsph170291111
UniProt: A3PIQ5
Position
1:1150915..1153101
Genome map
AA seq 728 aa AA seqDB search
MNVTSKPGELVPESDVAAIMRGTHGDPFRVLGMHGGGGAPLSVRVFAPQAAEVAVLGQGG
KVLASLERIGAEGFFAGTVPGEEKFPYRLRFVSGPHEWEADDPYRFPEVLGELDEYLLGE
GRHYQLYTRLGAHPAEIEGVQGVSFAVWAPNARRVSVVGAFNAWDGRRHPMRKRIGVGVW
ELFVPGLHTGDLYKYEILGPSGERLPLKSDPLSFAQEAPPATASVVHGLPEAEWHDAGWM
QERESRQRRDAPISIYEVHAGSWRQGLDYDALAEELSAYVREMGFTHVEFLPISEHPFTG
SWGYQPIGLFAPTARFGPPEGFARLVDRLHRDGIGVILDWVPAHFPSDAHGLANFDGTHL
YDHADPRQGFHRDWNTQIYNFGRQEVANFLQASALFWLDRYHVDALRVDAVASMLYLDYS
RNAGEWVPNRHGGRENLEAIDFLRGVNERVRLDHPGCITIAEESTAFPQVSRPVEDGGLG
FGFKWNMGWMHDTLGYFRRDPIHRKHHQNDLTFGMVYAYSEDFVLPLSHDEVVHGKGSLI
GQMAGDRWQKFANLRAYFGFMWAHPGKKLLFMGGEFAQEREWNHDASLDWHLLDDPSHAG
MKRLVADLNREYRKRPALHRMDCDPEGFEWIDAGDSENSVLSFLRKAPGEKPVLAVCNLT
PVVRSDYRIGVPEGGEWREILNSDAAIYGGSDVGNPGGLQAEEVSWHGRPASLRLTLPPL
ATIFVTPA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgacatcgaagcccggggagctcgtccccgaaagcgacgtggccgccatcatg
cgcggaacgcacggagatcccttccgcgtgctgggcatgcacggaggcggcggcgcgccg
ctctccgtccgggtcttcgccccgcaggccgcggaggttgcggtgctggggcaggggggc
aaggtgctcgcctctctcgaacgcatcggcgccgagggcttcttcgccggcacggtgccg
ggcgaggagaaattcccctaccgcctccgcttcgtctcggggccgcacgagtgggaggcg
gacgatccctaccgcttccccgaggtgctgggcgagctcgacgaatatcttctgggcgag
gggcggcactatcagctttatacccggctcggcgcgcatccggccgagatcgagggcgtg
caaggcgtgagcttcgccgtatgggcgccgaacgcccgccgcgtctcggtcgtgggcgcc
ttcaacgcctgggacggccgccgccacccgatgcgcaagcgcatcggcgtgggcgtgtgg
gagctgttcgttcccggccttcatacaggcgatctctacaaatacgagatcctcgggcct
tcgggcgagcggttgccgctcaagtccgacccgctctcctttgcgcaagaggcgccgccg
gccacggcttcggtggtccatgggctgcccgaggccgagtggcacgatgcgggctggatg
caggagcgcgagagccgccagcgccgcgacgcgccgatctcgatctacgaggtccatgcg
ggctcgtggcggcaggggctcgattacgacgcgctggccgaggaactgtcggcctatgtg
cgcgagatgggcttcacccatgtggagttcctgccgatcagcgaacatcccttcaccggc
tcttggggctatcagcccatcggcctcttcgcccccaccgcgcgcttcggcccgcccgag
ggcttcgcgcggctggtggaccggctccaccgcgacgggatcggcgtcatcctcgactgg
gtgccggcgcacttcccgtcggacgctcatgggctggccaatttcgacgggacccatctc
tatgaccatgccgacccgcggcagggcttccaccgcgactggaacacccagatctacaac
ttcggccggcaggaggtggcgaacttcctgcaggcctcggcgctcttctggctcgaccgc
taccatgtcgatgcgctgcgcgtggatgcggtggcctcgatgctctacctcgactattcg
cggaacgccggcgaatgggtgccgaaccgccacggcgggcgcgagaatctcgaggcgatc
gatttcctgcgcggcgtgaacgagcgcgtccggctcgaccatccgggctgcatcaccatc
gccgaggaatcgacggccttcccgcaggtgagccgcccggtcgaggacggcgggcttggc
ttcggcttcaagtggaacatgggctggatgcacgacacgctgggctatttccggcgcgac
ccgatccaccgcaagcaccaccagaacgacctgaccttcggcatggtctatgcctattcc
gaggatttcgtcctgcccctcagccatgacgaggtggtgcacggcaagggctcgctcatc
gggcagatggcgggcgaccgctggcagaagttcgcgaaccttagggcctatttcggcttc
atgtgggcccatccgggcaagaagctcctcttcatgggcggcgagttcgcgcaggagcgc
gagtggaaccacgatgcctcgctcgactggcacctgctcgacgatccgtcccacgccggg
atgaagcgcctcgtggccgacctgaaccgcgaatatcgcaagcgccccgcgctgcaccgg
atggattgcgatcccgaaggtttcgagtggatcgacgccggcgacagcgagaacagcgtg
ctgagcttcctgcgcaaggcgcccggcgaaaagccggtgctggcggtctgcaacctcacg
ccggtggtgcggtcggattaccggatcggggtgcccgagggcggcgagtggcgcgagatc
ctcaactccgacgccgcgatctacggcggctcggatgtgggcaatcccggcgggcttcag
gccgaggaagtcagctggcacggacgtccggcctcgctgcgcctgacgctgccgccgctt
gcgacgatcttcgtgacgcctgcatga

DBGET integrated database retrieval system