KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1114Help
Entry
Rsph17029_1114    CDS       T00484                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rsh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1156936..1158753
Genome map
AA seq 605 aa AA seqDB search
MSRTIEDRAAEFAIQPSYHALGGEFVRAPVETLREMLGAFGISLDGPPPDRAPPEMRAPE
GYRCFLPEGEMRRWGIAAQLYQLRSERNWGIGDFADLCDLARIGGAAGADFIGLNPLHAL
FLANPAHTSPFSPSNRRFLNPLYIAVDRVPGYRPEFAPEGLDQLRAPDLVDYPAVAAAKL
GALRRLWREGPDDAMGFMRFCAEGGELLRRHALFEAISGQMVADGYGAGWLGWPVEFHDA
EGQAVIDFADARGDEVGFHLWLQWIADRQLEEARDACRAAGMKIGLYLDFAVGEVPDGSS
TWSDPSLAVPGLRIGASPDWFNAQGQDWGLAPLSPVKLADLRAAPFGALMQDATRRAGAL
RIDHAMGVWQLFLIPDGMGAPQGTYVRYPIEDMLRALAEASCRNRTIVIGEDLGNVPDGF
RELMARMNILSYRILLFERHDHGYIAPEHYPREALVCLSTHDLPTFRGWWRGDDVAIRRD
FHLISDEAARQQGDFRWTERRQLLEDLARAGLMGWDEIDRIGPDDPPEALVVAVHRHLAR
APSRLFAVRIEDMAGEVAPVNVPSTVDEHPNWRRRLGVPLEALGETALFRGIAGALEAER
PREPS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaccatcgaagacagggcggccgagttcgccatccagcccagctatcacgcg
ctcggcggcgaattcgtccgcgcgccggtcgagacgctgcgcgaaatgctcggcgccttc
ggcatctcgctggacggaccgccgcccgaccgggcgccgcccgagatgcgggcgcccgag
ggctaccgctgcttcctgcccgagggcgagatgcgccgctggggcatcgccgcgcaactc
taccagctgcggtccgagcgcaactggggcatcggcgacttcgccgatctctgcgatctg
gcgcggatcggaggcgccgcgggggccgatttcatcggcctgaacccgctccacgccctg
tttctggccaatcctgcccacaccagccccttctcgccctcgaaccggcgcttcctgaac
ccgctctatatcgcggtcgaccgcgtgccgggctacaggcccgagttcgcgcccgagggg
ctggatcagctccgcgcgccggatctcgtggattatccggcggtggccgcagccaagctc
ggcgcgctgcgccgtctgtggcgcgaggggccggacgatgcgatgggcttcatgcgcttc
tgcgccgagggtggcgagcttctgcggcgccacgcgctcttcgaggcgatctcgggccag
atggtggcggacggctacggcgcgggctggctcggctggccggtggagttccacgacgcc
gaaggccaggccgtcatcgacttcgccgacgcacggggcgacgaggtgggcttccacctc
tggctgcaatggatcgccgatcggcagctcgaagaggcgcgcgatgcctgccgcgccgcc
gggatgaagatcgggctctatctcgacttcgccgtgggcgaggtgccggacggctcgagc
acctggtcggacccgagccttgccgtgccgggtctccggatcggcgcctcgcccgactgg
ttcaacgcgcaggggcaggactggggtctggcacccctctctccggtgaagctcgccgat
ctgcgagccgcgcccttcggggcgctgatgcaggatgccacgcgccgcgccggcgcgctg
cggatcgaccatgcgatgggcgtctggcagctgttcctcatccccgacgggatgggcgcc
ccgcagggcacctatgtgcgctatccgatcgaggacatgctgcgcgcgctggccgaagcc
tcgtgccgcaaccgcaccatcgtgatcggcgaagacttgggcaacgtgccagacggcttc
cgcgagctgatggcgcggatgaacatcctttcctaccgcatcctgctcttcgagcggcac
gaccacggctatatcgcgcccgagcattatccgcgcgaggcgctcgtctgcctgtccacc
cacgacctgcccaccttccgcggctggtggcggggcgacgatgtggcgatccggcgcgac
ttccacctgatctcggacgaggccgcccgccagcagggcgacttccgctggaccgagcgg
cgccagctgctcgaggatctggcgcgggcggggctgatgggctgggacgagatcgaccgg
atcggccccgacgatccgcccgaggcgctggtcgtggcggtgcaccgccatctcgcccgc
gcgccctcgcgcctcttcgcggtccggatcgaggacatggcgggcgaggtggccccggtg
aacgtgccctcgaccgtggacgaacatcccaactggcggcgcaggctcggcgtgccgctg
gaggctctgggcgagaccgcactgttccgcggcatcgccggagcccttgaagccgagcga
ccaagggagccctcatga

DBGET integrated database retrieval system