KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1224Help
Entry
Rsph17029_1224    CDS       T00484                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00040  Pentose and glucuronate interconversions
rsh00052  Galactose metabolism
rsh00500  Starch and sucrose metabolism
rsh00520  Amino sugar and nucleotide sugar metabolism
rsh01100  Metabolic pathways
rsh01130  Biosynthesis of antibiotics
Module
rsh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rsph17029_1224
   00052 Galactose metabolism
    Rsph17029_1224
   00500 Starch and sucrose metabolism
    Rsph17029_1224
   00520 Amino sugar and nucleotide sugar metabolism
    Rsph17029_1224
Enzymes [BR:rsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rsph17029_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABN76334
JGI: Rsph170291224
UniProt: A3PJ18
Position
1:complement(1273038..1274057)
Genome map
AA seq 339 aa AA seqDB search
MQVQHYMKHCSGQIGPSFSQIHIQRSRMSSQKVTTAIFPIAGMGTRFLPATKSIPKEILT
LVDKPLIQYAVEEAREAGIEDFIFVTSRGKGALEDFFDVNQTLERALRAAGKTELLATLE
ATNIDSGHVTYVRQHEALGLGHAVWCARRLVGDEPFAVILPDDMVVADKPCLAQMIAAHE
EVGGSIIATMEVPAEKASSYGVLDIEERQGALIRPRGIVEKPKAGTAPSNMAVIGRYILG
PRVMQHLDRRTVGAGGEIQLTDAIAHELATHPGSVHGFRFQGERFDCGSKAGFLQATVAL
ALEREDLRGEFSTFLRAIAEQHGLGAPSAAPLRSVAAAS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggtgcagcattatatgaaacattgttcgggtcagatcgggccctccttttcacag
atccatatccagaggtcgcgcatgtcttcccagaaggtcaccactgccattttccccatc
gcaggcatggggacgcggttcctgcccgcgaccaagtcgatcccgaaggaaattctcacg
ctcgtcgacaagccgctgatccagtatgcggtcgaggaagcccgcgaggccggcatcgag
gacttcatcttcgtcacctcccgcggcaagggggcgctcgaggacttcttcgacgtgaac
cagacgctggagcgggccctgcgcgcggcgggcaagaccgagcttctggcaacgctcgag
gccaccaacatcgacagcggccatgtgacctacgtccgccagcacgaggcgctgggcctc
ggccatgccgtctggtgcgcgcgtcgcctcgtgggcgacgagcccttcgcggtgatcctg
cccgacgacatggtggtcgccgacaagccctgcctcgcgcagatgatcgcggcccatgaa
gaggtcggcggcagcatcatcgccacgatggaagtgccggcggaaaaggcctcctcctac
ggcgtcctcgacatcgaagagcgtcagggcgcgctgatccgtccgcgcggcatcgtcgag
aaaccgaaagccggcaccgcgccctcgaacatggccgtcatcggccgctatatcctcggg
ccgcgcgtcatgcagcatctcgaccggcgcaccgtcggcgcggggggcgagatccagctg
accgacgccatcgcgcacgagctggccacccatccgggctcggtccacggcttccgcttc
cagggcgagcggttcgactgcggctcgaaggcgggcttccttcaggccaccgtcgcgctg
gcgctggagcgcgaggatctgcgcggggaattctcgaccttcctgcgggcgatcgccgag
cagcacggtctcggagccccgagcgccgcgccgctgcgcagcgtggcggccgcgagctga

DBGET integrated database retrieval system