KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1224Help
Entry
Rsph17029_1224    CDS       T00484                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rsph17029_1224
   00052 Galactose metabolism
    Rsph17029_1224
   00500 Starch and sucrose metabolism
    Rsph17029_1224
   00520 Amino sugar and nucleotide sugar metabolism
    Rsph17029_1224
Enzymes [BR:rsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rsph17029_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1273038..1274057)
Genome map
AA seq 339 aa AA seqDB search
MQVQHYMKHCSGQIGPSFSQIHIQRSRMSSQKVTTAIFPIAGMGTRFLPATKSIPKEILT
LVDKPLIQYAVEEAREAGIEDFIFVTSRGKGALEDFFDVNQTLERALRAAGKTELLATLE
ATNIDSGHVTYVRQHEALGLGHAVWCARRLVGDEPFAVILPDDMVVADKPCLAQMIAAHE
EVGGSIIATMEVPAEKASSYGVLDIEERQGALIRPRGIVEKPKAGTAPSNMAVIGRYILG
PRVMQHLDRRTVGAGGEIQLTDAIAHELATHPGSVHGFRFQGERFDCGSKAGFLQATVAL
ALEREDLRGEFSTFLRAIAEQHGLGAPSAAPLRSVAAAS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggtgcagcattatatgaaacattgttcgggtcagatcgggccctccttttcacag
atccatatccagaggtcgcgcatgtcttcccagaaggtcaccactgccattttccccatc
gcaggcatggggacgcggttcctgcccgcgaccaagtcgatcccgaaggaaattctcacg
ctcgtcgacaagccgctgatccagtatgcggtcgaggaagcccgcgaggccggcatcgag
gacttcatcttcgtcacctcccgcggcaagggggcgctcgaggacttcttcgacgtgaac
cagacgctggagcgggccctgcgcgcggcgggcaagaccgagcttctggcaacgctcgag
gccaccaacatcgacagcggccatgtgacctacgtccgccagcacgaggcgctgggcctc
ggccatgccgtctggtgcgcgcgtcgcctcgtgggcgacgagcccttcgcggtgatcctg
cccgacgacatggtggtcgccgacaagccctgcctcgcgcagatgatcgcggcccatgaa
gaggtcggcggcagcatcatcgccacgatggaagtgccggcggaaaaggcctcctcctac
ggcgtcctcgacatcgaagagcgtcagggcgcgctgatccgtccgcgcggcatcgtcgag
aaaccgaaagccggcaccgcgccctcgaacatggccgtcatcggccgctatatcctcggg
ccgcgcgtcatgcagcatctcgaccggcgcaccgtcggcgcggggggcgagatccagctg
accgacgccatcgcgcacgagctggccacccatccgggctcggtccacggcttccgcttc
cagggcgagcggttcgactgcggctcgaaggcgggcttccttcaggccaccgtcgcgctg
gcgctggagcgcgaggatctgcgcggggaattctcgaccttcctgcgggcgatcgccgag
cagcacggtctcggagccccgagcgccgcgccgctgcgcagcgtggcggccgcgagctga

DBGET integrated database retrieval system