KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1289Help
Entry
Rsph17029_1289    CDS       T00484                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00220  Arginine biosynthesis
rsh00330  Arginine and proline metabolism
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01130  Biosynthesis of antibiotics
rsh01230  Biosynthesis of amino acids
Module
rsh_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rsph17029_1289
   00330 Arginine and proline metabolism
    Rsph17029_1289
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rsph17029_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABN76399
JGI: Rsph170291289
UniProt: A3PJ83
Position
1:complement(1334101..1335027)
Genome map
AA seq 308 aa AA seqDB search
MRKTCILIGAPIDSGQRRPGCLMGPAAYRVAGLGRALADLGHAVEDRGDVALGPLPEVAP
PEGPVHDLPETIGWTAALKTAVEEALGDGFPIVMGGDHSLALGTVAGAAAHAAAVGRPLF
LLWLDAHSDFHTLQTTTSGNLHGVPVAYAAGRDGFDGFPPFPAPLPPERICLFGIRSVDP
EEHAALLLHDVSIIDMRVIDEFGICAPMREFLETVRAANGMLHVSLDVDFVDPAHAPAVG
TTVPGGATVREAHLVMELLHESGLVTSLDLVELNPFLDERGRTARLMVELAASIMGRKVF
DRPTRSFG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagacctgcatcctgatcggcgcgccgatcgacagcggccagcgccgcccgggc
tgcctgatggggcctgcggcctatcgcgtggcgggcctcggccgcgcgctcgccgatctc
ggtcacgcggtcgaggatcgcggcgacgtggccctcgggcccctgcccgaggtcgcgccg
ccggagggtccggttcacgacctgcccgagacgatcggctggacggccgcgctgaagacc
gccgtcgaagaggccttgggcgacggctttcccatcgtgatgggcggggatcattcgctc
gccctcggcaccgtggccggggccgcggcccatgcggcggcggtggggcggccgctgttc
ctcctctggctcgacgcccattccgacttccacacgcttcagaccaccacctccggcaat
ctccatggggtgcccgtggcctatgcggccgggcgcgacgggttcgacggcttcccgccc
ttccccgcgccgctgccgcccgagcggatctgcctcttcggcatccgctcggtcgatccc
gaggaacatgcggcgctcctcctccacgatgtctcgatcatcgacatgcgggtgatcgac
gaattcggcatctgcgcgccgatgcgcgagttcctcgagacggtgcgcgcggccaacggg
atgctgcatgtctcgctcgacgtggatttcgtcgatcccgcccatgcgcccgcggtgggc
accaccgttccgggcggcgccacggtgcgcgaggcgcatctggtgatggagcttctgcac
gagagcggtctcgtgacctcgctcgatctggtggagctgaacccgttcctcgacgagcgc
ggacgcaccgcgcggctgatggtggagctcgccgcctcgatcatggggcgcaaggtcttc
gaccggcccacgcgcagcttcggctga

DBGET integrated database retrieval system