KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1320Help
Entry
Rsph17029_1320    CDS       T00484                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rsph17029_1320
Enzymes [BR:rsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rsph17029_1320
Exosome [BR:rsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17029_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1366618..1368099)
Genome map
AA seq 493 aa AA seqDB search
MNHILAIDQGTTSSRAMVFDEALTLKSVAQEEFPQIYPRPGWVEHDPSDLWSSVAATARA
AVERAEIDGSLAAIGITNQRETVVVWERASGHPIHNAIVWQDRRTADLCHALAEAGHEPL
ITGRTGLLLDPYFSATKLKWLLDHVEGARARARRGELLFGTVDSYLIWKLTGGRAHVTDA
TNAARTMLFDIGRGIWDPEICGLLDIPMEMLPEVKDCAAPFGMTRADLFGREIPILGVAG
DQQAATCGQACFRPGMMKSTYGTGCFALLNTGEERVTSRARLLTTIAYQLGGKRTYALEG
SIFIAGAVVQWLRDGLKIIREAGETQGLALSSDAAQDLVIVPAFTGLGAPWWKPESRGAV
FGLTRNSGPAEFARAALESVGYQTRDLLEAMRADWAAGAEGVLRVDGGMAASDWSMQFLA
DIIGAPVDRPVVRETTALGVAWLAGMQAGLCPGPEEFAADWALERRFEPQMEASVREAKY
DRWGRAVRAVMAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacatcctcgccatcgatcagggcaccacctcgtcgcgcgcgatggtcttcgac
gaggccctcacgctgaagtcggtcgcgcaggaggaattcccgcagatctacccgcgcccg
ggctgggtcgagcacgacccctcggacctctggtcgagcgtcgccgccaccgcgcgcgcg
gcggtcgagagggccgagatcgacggcagcctcgcggcgatcgggatcaccaatcagcgc
gaaaccgtcgtcgtctgggagcgtgcctcggggcatccgatccacaatgccatcgtctgg
caggaccggcgcacggccgatctctgccatgccctggccgaggcggggcacgagcccctc
atcaccggccgcacgggcctgctgctcgatccctatttctcggccaccaagctcaagtgg
ctgctcgaccatgtggagggcgcccgcgcccgggcacggcggggcgagctgctgttcgga
acggtcgacagctacctgatctggaagctcaccggcgggcgcgcgcatgtgaccgacgcc
accaatgccgcgcgcaccatgctcttcgacatcggccgcggcatctgggacccggagatc
tgcggcctcctcgacattccgatggagatgctgcccgaggtcaaggattgcgcggccccc
ttcggcatgacgcgcgcggatctcttcgggcgcgagatcccgatcctcggcgtggcgggc
gaccagcaggccgccacctgcgggcaggcctgcttccggcccggcatgatgaaatcgacc
tacggcaccggctgcttcgcgctgctgaacaccggcgaggagcgggtgacgagccgcgcg
cggctgctgaccaccatcgcctatcagctgggcggcaagcgcacctatgcgctggagggt
tcgatcttcatcgcgggcgccgtggtgcagtggctgcgcgacgggctgaagatcatccgc
gaggcgggcgagacgcagggcctcgccctctcctcggacgcggcgcaggatctggtgatc
gtgcccgccttcaccggcctcggcgccccctggtggaagcccgagagccgtggcgcggtc
ttcgggctcacccgcaactcgggccccgcggaattcgcccgcgccgcgctcgaaagcgtg
ggctaccagacgcgcgacctgctcgaggcgatgcgggcggattgggcggcgggggccgag
ggcgtgctgcgggtcgatggcgggatggcggcctcggactggtcgatgcagtttctggcc
gacatcatcggcgcgccggtcgaccggccggtggtgcgcgagacgacggcgctcggcgtg
gcctggctcgcggggatgcaggcggggctctgcccggggccggaggagttcgccgccgat
tgggcgctggagcgacggttcgagccgcagatggaggcgtcggtgcgcgaggcgaaatac
gaccgttggggtcgggccgtgcgcgcggtgatggcggtatga

DBGET integrated database retrieval system