KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1320Help
Entry
Rsph17029_1320    CDS       T00484                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rsh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1366618..1368099)
Genome map
AA seq 493 aa AA seqDB search
MNHILAIDQGTTSSRAMVFDEALTLKSVAQEEFPQIYPRPGWVEHDPSDLWSSVAATARA
AVERAEIDGSLAAIGITNQRETVVVWERASGHPIHNAIVWQDRRTADLCHALAEAGHEPL
ITGRTGLLLDPYFSATKLKWLLDHVEGARARARRGELLFGTVDSYLIWKLTGGRAHVTDA
TNAARTMLFDIGRGIWDPEICGLLDIPMEMLPEVKDCAAPFGMTRADLFGREIPILGVAG
DQQAATCGQACFRPGMMKSTYGTGCFALLNTGEERVTSRARLLTTIAYQLGGKRTYALEG
SIFIAGAVVQWLRDGLKIIREAGETQGLALSSDAAQDLVIVPAFTGLGAPWWKPESRGAV
FGLTRNSGPAEFARAALESVGYQTRDLLEAMRADWAAGAEGVLRVDGGMAASDWSMQFLA
DIIGAPVDRPVVRETTALGVAWLAGMQAGLCPGPEEFAADWALERRFEPQMEASVREAKY
DRWGRAVRAVMAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacatcctcgccatcgatcagggcaccacctcgtcgcgcgcgatggtcttcgac
gaggccctcacgctgaagtcggtcgcgcaggaggaattcccgcagatctacccgcgcccg
ggctgggtcgagcacgacccctcggacctctggtcgagcgtcgccgccaccgcgcgcgcg
gcggtcgagagggccgagatcgacggcagcctcgcggcgatcgggatcaccaatcagcgc
gaaaccgtcgtcgtctgggagcgtgcctcggggcatccgatccacaatgccatcgtctgg
caggaccggcgcacggccgatctctgccatgccctggccgaggcggggcacgagcccctc
atcaccggccgcacgggcctgctgctcgatccctatttctcggccaccaagctcaagtgg
ctgctcgaccatgtggagggcgcccgcgcccgggcacggcggggcgagctgctgttcgga
acggtcgacagctacctgatctggaagctcaccggcgggcgcgcgcatgtgaccgacgcc
accaatgccgcgcgcaccatgctcttcgacatcggccgcggcatctgggacccggagatc
tgcggcctcctcgacattccgatggagatgctgcccgaggtcaaggattgcgcggccccc
ttcggcatgacgcgcgcggatctcttcgggcgcgagatcccgatcctcggcgtggcgggc
gaccagcaggccgccacctgcgggcaggcctgcttccggcccggcatgatgaaatcgacc
tacggcaccggctgcttcgcgctgctgaacaccggcgaggagcgggtgacgagccgcgcg
cggctgctgaccaccatcgcctatcagctgggcggcaagcgcacctatgcgctggagggt
tcgatcttcatcgcgggcgccgtggtgcagtggctgcgcgacgggctgaagatcatccgc
gaggcgggcgagacgcagggcctcgccctctcctcggacgcggcgcaggatctggtgatc
gtgcccgccttcaccggcctcggcgccccctggtggaagcccgagagccgtggcgcggtc
ttcgggctcacccgcaactcgggccccgcggaattcgcccgcgccgcgctcgaaagcgtg
ggctaccagacgcgcgacctgctcgaggcgatgcgggcggattgggcggcgggggccgag
ggcgtgctgcgggtcgatggcgggatggcggcctcggactggtcgatgcagtttctggcc
gacatcatcggcgcgccggtcgaccggccggtggtgcgcgagacgacggcgctcggcgtg
gcctggctcgcggggatgcaggcggggctctgcccggggccggaggagttcgccgccgat
tgggcgctggagcgacggttcgagccgcagatggaggcgtcggtgcgcgaggcgaaatac
gaccgttggggtcgggccgtgcgcgcggtgatggcggtatga

DBGET integrated database retrieval system