KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1436Help
Entry
Rsph17029_1436    CDS       T00484                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rsph17029_1436
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rsph17029_1436
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Rsph17029_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1489923..1490696)
Genome map
AA seq 257 aa AA seqDB search
MDLNGKRAIVTGSNSGIGLGCAEELARAGAEIVINSFTDRDEDHALAEKIGREHGVSCRY
IAADMSDGEACRALIETAGGCDILVNNAGIQHVSSIEEFPVEKWNAILAINLSSAFHTTA
AALPGMRAKGWGRIVNIASAHGLTASPYKSAYVAAKHGVVGFTKVTALETAGKGITCNAI
CPGYVLTPLVEAQIPDQMKAHDMDRETVIREVMLDRQPSRQFATTGQIGGTVVFLCSGAA
DQITGTTISVDGGWTAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaacggcaagcgggcaatcgtcaccggctcgaactcgggcatcgggctgggc
tgcgccgaagagctggcgcgcgccggcgccgagattgtcatcaactccttcaccgaccgc
gacgaggatcacgcgctggccgagaagatcggccgcgaacatggcgtgagctgccgctac
atcgcggccgacatgtcggacggcgaagcgtgccgggcgctgatcgagacggcgggcggc
tgcgatatcctcgtgaacaatgcgggcatccagcatgtctcgtcgatcgaggagtttccg
gtcgagaagtggaacgcgatcctcgcgatcaacctctcgtcggccttccacaccacggcg
gcggcgctgccggggatgcgggcgaagggctgggggcggatcgtcaacatcgcctcggcg
cacgggctgacggcgagcccctacaagtcggcctatgtcgcggccaagcacggggtggtg
ggcttcaccaaggtcaccgcgctcgaaaccgcgggcaagggcatcacctgcaacgcgatc
tgcccgggctatgtgctgacgccgctggtcgaggcccagatccccgaccagatgaaggcg
cacgacatggaccgcgagacggtgatccgcgaggtgatgctcgaccgccagccctcgcgg
cagttcgccacgaccggacagatcggcggcacggtcgtgttcctctgctcgggtgcggcc
gatcagatcaccgggacgacgatctcggtggatgggggctggaccgccctctga

DBGET integrated database retrieval system