KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1501Help
Entry
Rsph17029_1501    CDS       T00484                                 

Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rsph17029_1501
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Rsph17029_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1568854..1569948)
Genome map
AA seq 364 aa AA seqDB search
MKAARLYEYDPAMNVRLKIEDVPSPTIDRPDEVIVKVGAAGLCRTDLHIIEGVWRDIMDS
HGSLLPYIMGHENAGWVEDVGSGVTSVKPGDAVICHPLRTCGICLNCRHGHDMHCQNNLF
PGLGLDGGFAEYFKTSERSLIKLNTGITPLSVAPMADAGITAYRAAKRAAKLLNPGDWAL
ILGVGGLGHIALQVLNEMAGCRTIAVDREPGAQVLAKELGADKVLSGGPDLIEEVRQITG
GGARVVIDFVGELGIENLCWKLLKNGGDLIMVGYGGTIEIPTLELVAREIRIGGSLVGDY
TELVELMELNADGKVKMHQTEFALEDINTAIDDFKNRRFTGRGVIVPGAPSARRAEERTA
EAVK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcgaggctttacgaatacgacccggcgatgaacgtccggctgaagatcgag
gacgtcccttcgcccaccatcgaccggccggacgaagtgatcgtcaaggtgggtgcggcc
gggctctgccgcaccgatctgcacatcatcgaaggcgtctggcgcgacatcatggacagc
catggctcgcttctgccctacatcatggggcacgagaatgcgggatgggtcgaggacgtg
ggttcgggcgtgacctcggtgaaacccggcgacgcggtgatctgccatccgctgcggacc
tgcggcatctgcctgaactgccgccacggccatgacatgcactgccaaaacaatctcttt
cccggtctcgggctggacggcggttttgcggaatatttcaagacctccgagcggtcgctc
atcaagctgaacacggggatcacgccgctctcggtggcgccgatggccgatgccggcatc
acggcctaccgtgcggccaagcgggcggcgaagctgctcaatccgggcgactgggcgctg
atcctcggcgtgggagggctcggccatatcgccctgcaggtcctgaacgagatggcgggc
tgccggaccatcgcggtcgaccgcgagccgggcgcgcaggtgctcgcgaaggagctcggc
gcggacaaggtgctgtcgggcgggcccgaccttatcgaggaggtgcgccagatcaccggc
ggcggcgcccgggtggtgatcgatttcgtgggcgaactcggcatcgagaacctgtgctgg
aagcttctgaagaacggcggcgatctcatcatggtgggctatggcggcaccatcgagatc
ccgaccctcgagcttgtcgcgcgcgagatccgcatcggcggcagcctcgtcggcgactac
acggaactcgtggagctgatggagctgaacgccgacggcaaggtgaagatgcaccagacc
gaattcgcgctggaggacatcaatacggccatcgacgacttcaagaaccgccgcttcacg
ggacggggggtaatcgttccgggcgccccctcggccaggcgggccgaagagcgaacggcc
gaagccgtgaaatga

DBGET integrated database retrieval system