KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1521Help
Entry
Rsph17029_1521    CDS       T00484                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17029_1521
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17029_1521
   00052 Galactose metabolism
    Rsph17029_1521
   00500 Starch and sucrose metabolism
    Rsph17029_1521
   00520 Amino sugar and nucleotide sugar metabolism
    Rsph17029_1521
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rsph17029_1521
   00524 Butirosin and neomycin biosynthesis
    Rsph17029_1521
Enzymes [BR:rsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rsph17029_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1591472..1592425
Genome map
AA seq 317 aa AA seqDB search
MADAPLCLVADIGGTNTRVALAEGSRLRPETTRRFRNADYPALAPVLRDFLSVAGSPEID
GTCVAAAGPVRDGVALLTNLAWTVDGAELQRATGAPRVAVLNDLQAQGHALGHLDPANLH
VLIPGPTPRRAGPMLVVGVGTGFNAAPVHDVAGLRLVAASECGHAGMPVRTARDLRLAEF
VQTAHGFAGVEDVLSGRGLERLYAFTAAEAGLEDRKSAAEIMAAIAEPGPARAAAELFAR
LLGAEAGNLALIHLPFGGLYLCGGVARAFAAHLGPMGFAENFRDKGRFSAFMDDFPVCIV
EDDYAALTGCAAYLATL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcgcccctttgcctcgtcgccgacatcggtggcacgaacacccgcgtggcg
ctggcggagggatcccggctgcggcccgaaacgacgcgccgcttccggaatgccgattat
cctgctctggcgccggtcctgcgcgacttcctctccgtcgccggcagccccgagatcgac
ggcacctgcgtggccgccgcgggcccggtccgggacggggtggctctgctcacgaacctc
gcctggaccgtcgacggcgccgaactgcagcgcgcgaccggcgcgccgcgcgtggcggtg
ctgaacgatcttcaggcgcagggccatgcgctgggccatctggatccggccaatctgcac
gtcctgatcccggggcccactccccgccgcgcgggcccgatgctcgtcgtgggcgtcggc
accggcttcaacgcagcgcccgtccacgatgtcgctggcctgcgcctggtggcggcctcc
gagtgcggccatgccgggatgcccgtccgcacggcgcgcgacctccggctcgcggaattc
gtccagacggcccacggtttcgccggcgtcgaggatgtgctgtcgggccgcggtctcgag
cggctctatgccttcaccgcggccgaggccggcctcgaggaccgcaagtcggcggccgag
atcatggcggccattgccgaacccggcccggcgcgcgccgcggccgagctcttcgcccgc
ctcctcggcgccgaggcgggcaatctcgccctgatccacctgcccttcggcggcctctat
ctctgcggcggcgtggcccgggccttcgccgcccatctgggcccgatgggctttgccgag
aacttccgcgacaagggccgcttctcggccttcatggacgatttcccggtctgcatcgtc
gaggacgattacgcggccctcaccggctgcgcagcctacctcgccaccctctga

DBGET integrated database retrieval system