KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1554Help
Entry
Rsph17029_1554    CDS       T00484                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00330  Arginine and proline metabolism
rsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rsph17029_1554
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Rsph17029_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABN76664
JGI: Rsph170291554
UniProt: A3PJZ8
Position
1:complement(1634022..1634987)
Genome map
AA seq 321 aa AA seqDB search
MALEDAKNEVDVAFGGRGARGYAYENAFAGATSFLRRPYTKDLTGVDLAVTGVAFDQAVT
NRTGTRFGPRAIREASTLQPYDRPFGWGFDPLEELTVVDYGDLAFDYARTAEFPARLTAH
VAGILAAGAGALTLGGDHSITLPILRAHAAVFGPLSVVQFDAHSDLWVDDDPGRIDHGTF
MYKAVKEGLVDPARSVQVGIRTDTPDWLGMNVIDARTVHEQGPAAVAARVHAIVGHHPTY
LTFDIDALDPAFAPATGTPVWGGLASWQAAAILRDLAGLNLVGGDVVEVSPPYDPSGITA
VAGAHVAYELICLYGWRRRKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgaggatgcgaagaacgaggtggacgtcgccttcgggggccgcggcgcccgc
ggctacgcctacgagaacgcctttgccggggccacgagcttcctccgccgcccttacacg
aaggacctgacgggggtcgatctggcggtcaccggcgtggccttcgatcaggcggtgacg
aatcgcaccggcacccgcttcggaccccgcgcgatccgcgaagcctcgacgcttcagccc
tacgaccggccgttcggctggggcttcgatccgctggaagagctgacggtggtcgattac
ggcgacctcgccttcgactatgcccgcacggccgagtttcccgcccgcctcaccgcccat
gtcgcgggcatcctcgcggcgggcgcgggcgcgctcacgctcggcggcgatcattcgatc
accctgccgatcctgcgcgcccatgcggcggtgttcgggccgctttcggtggtgcagttc
gatgcccattccgatctctgggtcgatgacgatccgggccggatcgaccacggcaccttc
atgtacaaggcggtgaaagagggcctcgtcgatccggcccggtccgtgcaggtgggcatc
cgcaccgatacgcctgactggctgggcatgaacgtgatcgacgcgcggacggtgcacgaa
cagggcccggccgcggtcgcggcgcgggtgcatgcgatcgtgggccaccatcccacctac
ctcaccttcgacatcgacgcactcgacccggccttcgcgccggccaccggcacgccggtc
tggggcggcctcgcctcctggcaggccgcggcgatcctccgcgatctcgcgggcctgaac
ctcgtggggggcgatgtggtcgaggtctcgcctccctacgatccctccggcatcaccgcc
gtcgcgggcgcccatgtggcttacgagttgatctgtctctacggttggagaaggcgcaag
gaatga

DBGET integrated database retrieval system