KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1653Help
Entry
Rsph17029_1653    CDS       T00484                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rsph17029_1653
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rsph17029_1653
Enzymes [BR:rsh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rsph17029_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1745010..1745543
Genome map
AA seq 177 aa AA seqDB search
MRFIPTTLKDAVLIEAEPREDHRGWFERTFCMEEMAGAGLKTGFVQHNSSYNHAAGTLRG
MHYQRAPHSEVKVITCTRGRIQDVIIDLRPDSPTYLKWEGFDLKAGDHRQLYIPEGFAHG
YLTLEDATAVSYLVSAAYTPGAEGGVRWDDPAFGIDWAAEVSVISEKDAAWPDFQPA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagattcattcccacgacgctcaaggatgccgtcctgatcgaggccgagccgagagag
gatcaccggggctggttcgagcgcaccttctgcatggaggagatggccggtgccggcctg
aagacgggcttcgtgcagcacaacagctcctacaaccatgccgcaggaacgctgcgcggg
atgcactaccagcgcgcgccccattcggaggtgaaggtcatcacctgcacccgcggccgc
atccaggacgtcatcatcgacctgcgcccggactcgccgacctacctgaaatgggagggg
ttcgatctgaaggcgggcgatcaccggcagctctatatccccgaaggcttcgcccacggc
tatctgacgctcgaagatgcgacggccgtgtcctacctcgtctcggcggcctacacgccc
ggcgcggaaggcggcgtgcgttgggacgatcccgctttcgggatcgactgggccgccgaa
gtgtcggtgatctcggaaaaggatgcggcctggccggacttccagccggcctga

DBGET integrated database retrieval system