KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1682Help
Entry
Rsph17029_1682    CDS       T00484                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsph17029_1682
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rsph17029_1682
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rsph17029_1682
Two-component system [BR:rsh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rsph17029_1682
Bacterial motility proteins [BR:rsh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rsph17029_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1774232..1775329)
Genome map
AA seq 365 aa AA seqDB search
MKVGNTLMAARAREGRTRVLIVDDSAMVRQALALGLSTDPRLEVVGTASGAEAARAQMAA
LKPDVVTLDLEMPQMDGLTFLRSYMESAPVPTVVISSLTRTSGETAMRAMEAGAVDIISK
PSLGAGQGLPAIMRDVCARVWAAARARLALPDGAAPAPVAPGASEDWIHALGASTGGVQA
LSRILPFFPAQSPGLLVVQHMPEGFTAAFARRLDALCRMRVREAADGDLVLPGLVLIAPG
GLRHMEIERAGGVCRVRLVAGAPVSYSRPSVDRMFLSLAAAAGPRVSAALLTGMGRDGAA
GLLAIRRAGGRTFAQDEGSSAVFGMPLAARDLRAAEEILTLDDIPARMMLAAAADTRAPS
LASND
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttggcaataccctgatggccgcgagggcccgcgaggggcgcacgcgcgtgctg
atcgtggacgattccgccatggtccggcaggcgctggcgctggggctttcgaccgacccg
cggctcgaggtggtgggcaccgcctcgggcgccgaagccgcgcgcgcacagatggccgcg
ctgaagcccgacgtggtgacgctcgatctcgagatgccgcagatggacgggctcaccttc
ctgcgcagctacatggagagcgcgccggtgcccacggtcgtcatctcctcgctcacgcgg
acgagcggcgagacggccatgcgcgccatggaggcgggcgccgtcgacatcatctcgaaa
ccctcgctcggcgcaggccaggggctgcccgcgatcatgcgcgacgtctgtgcccgggtc
tgggctgccgcgcgcgcgcggctcgcgctgcccgacggcgcggcgcccgcccccgtcgcg
cccggtgcctcggaggactggatccacgcgctcggcgcctccaccggcggggtgcaggcc
ctgagccgcatcctgcccttcttcccggcccagtcgcccggcctcctcgtcgtccagcac
atgcccgagggcttcaccgcggccttcgcgcgccgcctcgatgcgctctgccggatgcgg
gtgcgcgaagcggccgacggcgatctcgtgctgccgggcctcgtgctgatcgcgcccggc
gggctgcgccacatggagatcgagcgggcgggcggggtctgccgggtgcggctcgtggcg
ggggcaccggtctcctactcgcgcccctcggtcgaccggatgttcctgtcgctggccgcg
gccgccggtccgcgcgtctcggccgcgctcctgaccggcatggggcgcgacggcgcggcc
ggtcttctcgcgatccgccgcgccggcgggcgcaccttcgcgcaggacgagggctcgtcg
gccgtcttcggcatgccgcttgcagcacgcgacctgcgggcggccgaagagatcctgacg
ctcgacgatatcccggcccgcatgatgctggccgcggcggcggacacgcgggcgcccagc
ctcgcgtcaaacgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system