KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1872Help
Entry
Rsph17029_1872    CDS       T00484                                 

Definition
serralysin (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     Rsph17029_1872
Peptidases [BR:rsh01002]
 Metallo Peptidases
  Family M10
   Rsph17029_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1980787..1982382)
Genome map
AA seq 531 aa AA seqDB search
MFLSSLFPTFAGQGPETALTDRDGRAEAAAFQTTAANRLAAEPAVASMREIADQLVSGYW
RSEGHSIRRFDVEPGDTLNVNLSGLTADGQRLARAALDTWADVTGLKFNTAPRFGATVHI
VIDDRENGAHSTATLSGGRLIKANVNVGRDWLADYGTDLNSYSLQTFIHEIGHALGLGHA
GNYNGSADYASDALFLNDSWQASVMSYFSQTENSYIDADKAFVVTPMIADILAIQTLYGT
PGGLRADSTVYGTGSTAGGMYDRAATLTAEPVAWTIFDQGGWDRLDLRGAEAPQLIDLRP
GAISDIYGAKGNLSIAPGTVIEAARGGSGNDRLIGNGVANVLNGGGGSDIMRGGAGNDIY
HSDGLDRIVELPGQGIDRVISTASCTLAANVENLTLAGGRAITGTGNGLANVITGNAAAN
RLTGGAGADSFVFATALGRGNVDRITDFSVADDTIRLDDAIFRALPRGSLADAAFAANAA
GRALDALDRILYETDTGALWYDRDGTGAAAAVRFAWVTPELALTAADFLVI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttcctttcctcgcttttccccactttcgccgggcaagggcccgaaaccgcactgacg
gaccgcgacggacgcgccgaggccgctgccttccagacgaccgcggcgaacaggctcgct
gccgaaccggcggtggcctcgatgcgcgagatcgccgatcagctcgtcagcggctattgg
cggtcggagggccactccatccgccgcttcgacgtggagccgggagacacgctgaacgtg
aacctgtctggtctgacggccgatggccagcgtctcgcgcgggccgcgctggacacctgg
gcggatgtcacggggctgaagttcaatacggccccccgcttcggcgcgacggttcatatc
gtgatcgacgacagggagaacggggctcactccacggccaccctgtcgggcggacggctg
atcaaggcaaatgtgaatgtcggccgcgactggctcgcggactacggcaccgacctgaac
agctacagcctgcagaccttcatccacgaaatcggccatgcgctgggtctcggccatgcc
ggcaactacaacggctcggccgattatgcgagcgacgcgctctttctgaacgatagctgg
caggccagcgtcatgtcctatttcagtcagaccgagaacagctacatcgacgccgacaag
gcgttcgtcgtgacgccgatgatcgccgacattctggcgatccagacgctctacggcacg
ccgggcgggctgcgggcagacagcacggtctatggcacgggctcgacggcgggcggcatg
tatgaccgcgcggcgaccttgaccgcggaacccgtggcctggacgatcttcgaccagggc
gggtgggacaggctcgacctgcgcggggcagaggctccgcaactcatcgacctgcggccg
ggcgcaatttcggacatctatggcgcgaagggcaatctctcgatcgccccgggcacggtg
atcgaggccgcgcggggcggcagcggcaacgaccggctcatcggcaacggcgtggccaac
gtcctgaacggcggcgggggctcggacatcatgcgcggcggggcgggcaacgacatctac
cacagcgacggcctcgaccggatcgtggagcttccggggcaggggatcgaccgggtgatc
tcgacggcgagctgcacccttgcggccaatgtggagaacctgacgctggcgggcggacgg
gccatcaccggcacgggcaacgggcttgcgaacgtcatcacgggcaatgcggcggccaac
cgcctgaccggcggggccggtgccgacagcttcgtcttcgcgaccgcgctcggccgcggc
aacgtcgacaggatcacggatttctcggtggccgacgacacgatccgcctcgacgacgcc
atcttccgggcgctgccgcggggcagtctggccgacgcggcattcgcggccaatgcggcg
gggcgggcgctcgacgcgctcgaccgcatcctctacgagaccgacacgggcgcgctctgg
tatgaccgcgacgggacgggtgccgcggccgccgtgcgcttcgcttgggtgacgccagag
cttgcgctgaccgccgccgatttcctcgtgatctga

DBGET integrated database retrieval system