KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1917Help
Entry
Rsph17029_1917    CDS       T00484                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rsph17029_1917 (bchD)
Enzymes [BR:rsh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rsph17029_1917 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2030820..2032496
Genome map
AA seq 558 aa AA seqDB search
MPLGPWERVEAALTLLAIDPAGLKGLWLRARASALRDRITGALGALPLPVRRIHPTIGDD
ALFGGLDLAATLSAGTPVVQKGILDEPAVLVIAMAERTLPGLAARLGTALDAPRHCLIAL
DEGAERDELLPLGLVDRLALFLDLDGLPWGETREIALDPERLAAARARLGAVATPPEAAA
TLARVAAQLGIASLRAPTLALAAARAQAAWEGHAAVTDEDIRRAADLVFAHRAMPASEEA
PPEPEPEPPEDQPDDSPPPPEQQQGEEMFPEEMLVEAVRAALPADLLEQLAAGRAARMAR
GATGTGSAKAGNRRGRPLPSRMGRLGTGARIDLVGTLRAAAPWQPLRRRQQQTDAVLLVR
PSDIRIKRFRETSDRVLIFAVDASGSSAMARLSEAKGAVELLLGQAYARRDHVSLLAFRG
RDAELILPPTRSLVQTKRRLAGLPGGGGTPLAHGLRLALAVGLQARARGMTPTVALLTDG
RGNIALDGSANRAQAEEDALKLAASLRGSGLPAVVIDTANRPQPSLAALARALDAPYIAL
PRADAHKLSNVLGAAMGD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcggcccgtgggaacgggtcgaggcggccctcacccttctcgccatcgaccct
gcaggcctcaagggcctctggctccgggcgcgggccagcgcgctgcgcgaccggatcacc
ggggcgctcggcgcgctgccgctgccggtccgccgcattcatccgaccatcggcgacgat
gcgctcttcggcgggctggatctggccgcgaccctctcggccggcacgcccgtcgtgcag
aagggcatcctcgacgagcccgcggtgctcgttatcgccatggccgagcgcaccctgccc
ggtctcgcggcccggctcggcaccgcgctcgatgcgccgcgccactgtctgatcgcgctc
gacgagggcgccgagcgcgacgaactgctgccgctcggcctcgtggaccggctggcgctg
ttcctcgaccttgacggcctgccctggggcgagacccgcgagatcgcgctcgaccccgag
cgcctcgccgccgcccgcgcccggctgggcgcggtggcgacaccgcccgaggcggccgcg
accctcgcccgcgtggcggcgcagctgggcatcgcgagcctccgcgcgccgacgctggcg
ctggccgcggcccgcgcgcaggccgcctgggaaggtcacgccgccgtcaccgacgaggac
atccgccgcgcggccgatctcgtcttcgcccatcgcgccatgcctgcctccgaggaggcc
ccgccggagcccgagcccgagccgcccgaggatcagcccgacgacagtccgccgccgccc
gagcagcagcagggcgaggagatgtttcccgaagagatgctggtcgaggccgtgcgggcg
gcgctgccggccgatctcctcgagcagctggccgcaggccgcgccgcgcggatggcgcgg
ggcgccaccggcaccggctcggccaaggccggcaaccgccgcggccgccccctgccctcg
cgcatgggccgcctcggcaccggcgcgcggatcgacctcgtgggcacgctgcgcgcggcc
gccccctggcagccgctccgccgccgccagcagcagaccgacgccgtcctgctcgtgcgg
ccctccgacatccgcatcaagcggttccgcgagacctcggaccgcgtgctgatcttcgcc
gtggatgcctcgggctcttccgccatggcgcgcctctccgaggcgaagggcgcggtcgag
cttcttctggggcaggcctatgcccggcgcgaccatgtctcgcttctggccttccggggc
cgcgacgccgagctgatcctgccgcccacccgcagcctcgtgcagacgaagcggcgcctt
gcgggcctgcccggcgggggcggcacgccgctcgcccacgggctgcggctggcgctggcc
gtggggcttcaggcccgcgcgcgcggcatgacgcccacggtcgcgcttctgaccgacggg
cgcggcaacatcgcgctcgacggatcggccaaccgggcgcaggccgaggaggatgcgctg
aagctcgcggcctcgctgcgcggctcgggtctgcccgcggtcgtgatcgacacggcgaac
cgcccgcagccgtcgctggcggccctcgcccgtgccctcgacgcgccctacatcgccctg
ccgcgggccgatgcccacaagctctcgaacgtcctcggcgcagcaatgggagactga

DBGET integrated database retrieval system