KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1940Help
Entry
Rsph17029_1940    CDS       T00484                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rsph17029_1940
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsph17029_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:2057739..2058176
Genome map
AA seq 145 aa AA seqDB search
MKFQVKALAAIAAFAALPALAQEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPN
LYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGK
MTFKLKKEADAHNIWAYLQQVAVRP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccaagtcaaggccctcgccgccatcgccgccttcgcggcgctgccggcgctc
gcgcaggaaggcgacccggaagccggggccaaggccttcaaccagtgccagacctgccac
gtcatcgtggacgattccggcaccaccatcgccggccgcaacgccaagaccggcccgaac
ctctacggcgtcgtgggccgcaccgcgggcacgcaggccgacttcaagggctatggcgaa
ggcatgaaggaagccggcgcgaaagggctcgcctgggatgaagagcatttcgtccagtat
gttcaggatccgaccaagttcctgaaggaatataccggcgacgcgaaagccaagggcaag
atgaccttcaagctgaagaaggaagcggacgcccacaacatctgggcctacctccagcag
gtcgccgtccggccctga

DBGET integrated database retrieval system