KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2207Help
Entry
Rsph17029_2207    CDS       T00484                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rsph17029_2207 (ruvA)
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rsph17029_2207 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2337785..2338459)
Genome map
AA seq 224 aa AA seqDB search
MIGKVAGILDFRGPDHVLIDVRGVGYIVYVSDRTLASMPGLGEGVALYTELVVREDLLQL
FGFPTMIEKEWHRLLMTVQGVGAKAGMAILGALGAEGTARAITLGDARSIQAAPGIGPKI
AQRVVLELKSKAPALMAMGGGTAALAPSEPPEPEPGTSSGSRRKTRAPEPPRPSHTADAL
SALANLGYQPTDAAQAVAQAAGESPDADTAALIRAALKLLAPKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaggtggcggggatcctcgacttccgcggcccggatcatgtgctgatcgac
gtccgcggcgtgggctacatcgtctatgtctcggaccggacgctggcctcgatgccgggt
ctgggcgagggggtcgctctctataccgagctcgtggtgcgcgaggatctgctgcagctc
ttcggcttccccacgatgatcgagaaggaatggcatcggctgctgatgacggtgcagggc
gtgggggccaaggccgggatggcgatcctcggcgcgctcggggcggaagggaccgcgcgg
gcgatcacgctcggcgatgcgcgctcgatccaggccgcgccggggatcgggcccaagatc
gcgcagcgggtggtgctggagctgaagagcaaggcgcccgcgctgatggcaatgggcggc
ggcacggcggcgctggcgccctccgagcccccggagcccgagcccggcacgtcgtccggc
agccgccgcaagacccgcgcgcccgagccgccgcggcccagccacacggccgacgcgctc
tcggccctcgccaatctcggctaccagccgaccgatgcggcgcaggccgtcgcgcaggcc
gcaggcgagagcccggacgccgatacggccgcgctgatccgggccgccctgaagctgctc
gcgccgaagtcgtag

DBGET integrated database retrieval system