KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2232Help
Entry
Rsph17029_2232    CDS       T00484                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rsh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsh00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsh00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rsh00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rsh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2364186..2366147)
Genome map
AA seq 653 aa AA seqDB search
MDHAQANAVYTASADFIAQAHVDAAGYERMYAASVADPEAFWGEQGKRLDWIKPYTKVKN
TNFRPGEVSIKWFEDGTLNIAWNCIDRHLATRAKQTAIIWEPDDPNAPAQHISYQELHDN
VCRMANVLVSQGVRKGDRVVMYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDALANRIN
DCQAKVVITADTAPRGGRRTPLKSNTDAALLHCSDRVRCLVVKHTGDQIHWMDGRDVDVK
ELMRHASPDCPIEEVNAEDPLFILYTSGSTGKPKGVVHTSGGYLTYAAMTHQMTFDYHDG
DVFWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWAVCEKHKVNQFYTAP
TAIRSLMGLGPEWVDKYDLSSLKLLGSVGEPINPEAWSWYNTHVGKGRCPIVDTFWQTET
GGHMITPLPGAIPVKPGAASKPFFGVKPVILDPTDGHELHETATEGVLCIADSWPGQMRT
LWGDHERFEEAYFSQYKGYYFTGDGCRRDADGYYWVTGRVDDVINVSGHRMGTAEVESAL
VAHAQVAEAAVVGYPHDIKGQGIYAYVTLMNGVQPTEELRKDLVKWVRTEIGPIASPDVI
QWAPGLPKTRSGKIMRRILRKIAENDFGSLGDTTTLADPSVVDDLIANRKNRG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctcaggcgaatgcggtctataccgcgtcggcagatttcattgcgcaagcc
catgtcgacgcggccggctacgagcggatgtatgctgcatccgtggccgacccggaggcg
ttctggggcgaacagggcaagcggctcgactggatcaagccctacaccaaggtcaagaac
acgaacttccggccgggcgaggtctcgatcaagtggttcgaggacggcacgctgaacatc
gcctggaactgcatcgaccggcatctggcgacgcgggccaagcagaccgcgatcatctgg
gagccggacgatccgaacgcgcctgcccagcacatcagctatcaggagctgcacgacaac
gtctgccggatggcgaacgtgctggtgagccagggcgtgcgcaagggcgaccgggtggtg
atgtatctgccgatgatccccgaggccgcctatgcgatgctggcctgcgcccggatcggc
gccatccattccgtcgtctttgcgggcttctcgcccgacgcgctggcgaaccggatcaac
gactgtcaggccaaggtggtcatcaccgccgacacggctccgcgtggcggccggcgcacg
cccctgaagtcgaacaccgacgcagcccttctccattgctcggaccgggtgcgctgcctc
gtcgtgaagcacacgggcgaccagatccactggatggacggccgcgacgtggacgtgaag
gagctgatgcgccacgcctcgcccgattgcccgatcgaggaggtgaatgccgaggatccg
ctcttcatcctctacacctcgggctcgaccggcaagccgaagggggtcgtgcacacctcg
ggcggctatctgacctatgccgccatgacccatcagatgaccttcgactaccatgacggc
gacgtcttctggtgcaccgcggacgtgggctgggtcacgggccacagctacatcgtctac
ggcccgctggcgaacggggccaccacgctcatgttcgagggcgtgccgacttatcccgat
gcgggccgcttctgggccgtctgcgagaagcacaaggtcaaccagttctacaccgcgccc
acggcgatccgctcgctgatgggcctcgggccggaatgggtcgacaagtacgacctgtcg
tcgctgaagctcttgggctcggtcggcgagccgatcaaccccgaggcctggagctggtac
aacacccatgtcggcaagggccgctgcccgatcgtcgacaccttctggcagaccgagacc
ggcggccacatgatcacgccgctgccgggcgcgatcccggtgaagccgggcgcggcctcg
aagcccttcttcggggtgaagccggtgatcctcgacccgaccgacgggcacgagctgcac
gaaaccgcgaccgagggggtgctctgcatcgccgacagctggccggggcagatgcgcacg
ctctggggcgaccacgagcggttcgaagaggcctatttctcgcagtacaagggctattac
ttcaccggcgacggctgccgccgcgatgcggacggctattactgggtcacgggccgggtc
gatgacgtcatcaacgtctcgggccaccggatgggcaccgccgaggtggaatccgctctc
gtcgcccatgcgcaggtcgccgaggccgcggtggtgggctatccgcacgacatcaagggg
cagggcatctatgcctatgtcacgctgatgaacggggtccagccgaccgaggagctgcgc
aaggatctggtgaaatgggtccgcaccgagatcggccccatcgcctcgccggacgtgatc
cagtgggcgccgggcctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgt
aagatcgccgagaacgacttcggctcgctcggcgacaccacgacgctggccgatccgtcg
gtggtcgacgacctgatcgccaaccgcaagaatcggggctga

DBGET integrated database retrieval system