KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2360Help
Entry
Rsph17029_2360    CDS       T00484                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsph17029_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABN77462
JGI: Rsph170292360
UniProt: A3PM96
Position
1:complement(2497605..2498129)
Genome map
AA seq 174 aa AA seqDB search
MFDTMTLTKAVGAGCGALLVFLLGSWAASGLYTFGEGHGEDVTQAYVIDTGASAAAEEPA
AEAVPFPELVAAADAAAGQKVFAKCAACHKVDGSDATGPHLNGVVDRAVASVAGFAYSDA
MVAHAAEAPTWTLEELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLASLQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacgatgaccctgacgaaggcggtcggcgccgggtgcggcgcgctcctggtg
ttcctgcttggatcctgggcggccagcggcctttacaccttcggcgagggccacggcgag
gatgtgacgcaagcctatgtgatcgacacgggcgccagtgccgccgccgaggaaccggcc
gccgaagcggtgccgttcccggaactggtggctgcggccgatgcggcggcgggccagaag
gtcttcgcgaaatgcgccgcctgtcacaaggtcgacggctcggacgcgaccggcccgcat
ctgaatggtgtggtcgaccgcgcagtggcctcggtggcgggcttcgcctattcggacgcg
atggtggcccatgccgccgaggcgccgacctggacgctggaagagctcggcgccttcgtc
gagaatcccaagggccatgtgcctggcaccaagatgaccttcgcgggcctgccgaaagag
caggatcgcgccaatgtcgtggcctatctggcctcgctccagtaa

DBGET integrated database retrieval system