KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2367Help
Entry
Rsph17029_2367    CDS       T00484                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rsph17029_2367
DNA repair and recombination proteins [BR:rsh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Rsph17029_2367
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rsph17029_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2505161..2505760
Genome map
AA seq 199 aa AA seqDB search
MAEAPGDIERLIELMARLPGLGPRSARRAVLLMLKKRGAVMAPLAQAMAEVATSARDCVR
CGNITNADLCGICRDERRATGELCVVEDVADLWALERAGAFRGRYHVLGGVLSALDSVGP
EELRIPRLAERVREEGISEVILALNATVDGQTTAHYIADVLEPSGVQVTSLAQGVPIGGE
LDYLDDGTIGAALRARRRF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcccccggcgacatcgagcgtctgatcgagctgatggcgcggctgccgggg
ctcgggccccgctccgcccgccgggcggtgcttctgatgctgaagaagcggggggccgtc
atggcccctctggcacaggccatggccgaagtcgcgaccagcgcgcgcgactgtgtgcgc
tgcggcaacatcacgaacgccgatctctgcgggatctgccgcgacgagcgccgcgccacg
ggcgagctctgcgtggtggaggatgtggccgacctctgggcgctcgagcgcgcaggcgcc
ttccgcggccgctatcatgtgctgggcggcgttctctcggcgctggattcggtgggcccc
gaggagctgcgcatcccccgccttgccgagcgggtgcgcgaggagggcatctccgaggtg
atcctcgcgctcaatgccacggtggacggccagaccacggcccattacatcgccgacgtg
ctcgagccttcgggcgtgcaggtcacgtcgctggcccagggcgtgcccatcggcggcgag
ctcgactatctcgacgacggcaccatcggtgccgccctccgcgcccgccggcggttctga

DBGET integrated database retrieval system