KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2489Help
Entry
Rsph17029_2489    CDS       T00484                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17029_2489 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17029_2489 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17029_2489 (trpA)
Enzymes [BR:rsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17029_2489 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2623513..2624304)
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFRRLRAEGKKAFVAYIMAGDPDLETSLAVMRGLPEAGVDIIELGMPFTDPMAD
GPTIQTAGQRALEGGQTLTRTLEMVRAFRAENAETPIVMMGYYNPIYARGVETFLAEATE
AGIDGLIVVDLPPEEDAELCLPAQAAGLNFIRLATPTTDSRRLPKVLQNTSGFVYYVSIT
GITGAAAAQAADVAPEVARIKAATDLPVIVGFGITTPEAAQDLAGIADGCVVGSAIVKLV
GEGRPVAEVLDRVAALAAGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgacgacaccttccggcggcttcgggccgaggggaagaaggccttcgtg
gcctatatcatggcgggcgatcccgatctcgagacgtcgcttgcggtgatgcggggcctg
ccggaggcgggcgtggacatcatcgagctgggcatgcccttcaccgatccgatggccgac
ggcccgacgatccagacggccggccagcgcgccctcgagggggggcagacgctgacccgg
acgctcgagatggtgcgcgccttccgggcggagaatgccgagacgcccatcgtgatgatg
ggttactacaatccgatctatgcgcgcggcgtcgagaccttcctcgccgaggcgacggag
gccgggatcgacgggctgatcgtggtggacctgccgcccgaggaggatgccgagctctgc
ctgcccgcacaggcggcggggctgaacttcatccggctcgcgacccccaccaccgacagc
cgccgcctgcccaaggtgctgcagaacacctcgggcttcgtctattacgtctcgatcacc
ggcatcaccggcgcggcggccgcgcaggcggccgatgtggcgcccgaagtggcgcgcatc
aaggccgcgacggatctgccggtcatcgtgggcttcggcatcaccacccccgaggccgcg
caggacctcgcgggtatcgccgacggctgcgtggtgggctcggcgatcgtgaagctcgtg
ggcgagggccggccggtggccgaggtgctggaccgggtggcggcgctcgcggccggcgct
cacgcggcctga

DBGET integrated database retrieval system