KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2635Help
Entry
Rsph17029_2635    CDS       T00484                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00020  Citrate cycle (TCA cycle)
rsh00190  Oxidative phosphorylation
rsh00650  Butanoate metabolism
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01120  Microbial metabolism in diverse environments
rsh01130  Biosynthesis of antibiotics
rsh01200  Carbon metabolism
Module
rsh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsph17029_2635
   00650 Butanoate metabolism
    Rsph17029_2635
  Energy metabolism
   00190 Oxidative phosphorylation
    Rsph17029_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABN77737
JGI: Rsph170292635
UniProt: A3PN21
Position
1:2782560..2782931
Genome map
AA seq 123 aa AA seqDB search
MRFITARKRAEGMGAAHHGTDRHWYMIVSAVGLAVLIPIFVYIVGNAIGEGRERVLEIFS
HPFNAILSGLVLFFGMRHFAEGSTMMIEDYWQGVPRRLLVICAQSFAYGVAAIGLFALAK
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcatcaccgcccgcaagcgcgccgaaggcatgggtgccgcccatcacggcacc
gaccggcactggtacatgatcgtgagcgcggtgggcctcgccgtgctgatcccgatcttc
gtctacatcgtcggcaacgccatcggcgaaggccgcgagcgcgtgctcgagatcttctcg
cacccgttcaatgcgatcctgtcgggcctcgtgctgttcttcggcatgcgccacttcgcc
gagggctcgaccatgatgatcgaggactactggcagggcgtgccgcggcgcctgctggtg
atctgcgcccaatccttcgcctacggcgtggcggcgatcgggctgttcgccctcgccaag
atcgccctctga

DBGET integrated database retrieval system