KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2812Help
Entry
Rsph17029_2812    CDS       T00484                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00329  
NADH dehydrogenase [EC:1.6.5.3]
K00356  
NADH dehydrogenase [EC:1.6.99.3]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rsh00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2962096..2963082)
Genome map
AA seq 328 aa AA seqDB search
MSKLVTIYGGSGFVGRYIARRMAQEGWRVRVAVRRPNEALFVKPYGVVGQVEPVFCNIRD
DASVRAVMHGADAVVNCVGILAESGKNRFQSVQAEGAARVARLAAAEGVQTLVQLSAIGA
DAQSPSAYGRTKAAGEAAVREAFPRAVILRPSVIFGPEDDFFNRFAQMTRFSPVLPVVGG
ATKFQPVFVDDVAQAAVAGVLGRAAPGTYELGGPDVETFRDLMKMLLRVVERRKLIVNVP
FWVANLIGGALDLVQTATFGLLANKTLTRDQVRNLRRDNIVAPDAKGLADLGISPTAMEA
VLPEYLWSFRPSGQYASIKASARNLRKT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcttgtgacgatctacggcgggtcgggcttcgtggggcgttacatcgcccgc
cggatggcccaggaaggctggcgcgtgcgcgtggccgttcgccgtccgaacgaggcgctg
ttcgtcaagccctacggtgtcgtggggcaggtggagcccgtcttctgcaacatccgcgac
gatgcctcggtgcgcgccgtcatgcacggcgcggatgcggtggtgaactgcgtggggatc
cttgccgaaagcggcaagaaccgattccagtcggtgcaggccgaaggcgcggcccgcgtg
gcgcggctcgccgctgccgagggcgtgcagacgctggtgcagctgtcggccatcggcgcc
gacgcgcagtcgccgagcgcctatggccgcaccaaagccgcgggcgaggccgccgtgcgc
gaggccttcccgcgggcggtgatcctgcgtccgtcggtgatcttcggacccgaggacgat
ttcttcaaccgcttcgcccagatgacgcgcttcagcccggtgctgccggtcgtcggcggc
gcgacgaaattccagccggtcttcgtcgatgacgtggcgcaggcggcggtggcgggcgtc
ctcggccgggcggcgccgggcacctacgaactgggcggcccggatgtggagaccttccgc
gacctgatgaagatgcttctgcgcgtggtcgagcggcgcaagctgatcgtgaacgtgccc
ttctgggtcgcgaacctgatcggcggcgcgctggatctggtgcagacggcgaccttcggg
ctgctggccaacaagaccctgacccgcgatcaggtgcgcaacctccgccgcgacaatatc
gtggcccccgacgccaagggcctcgccgatctcggcatctcgcccaccgcgatggaggcc
gtgctgccggaatatctctggagcttccggccgtcgggtcaatatgcctcgatcaaggct
tcggcgcggaacctgcgcaagacctga

DBGET integrated database retrieval system