KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2812Help
Entry
Rsph17029_2812    CDS       T00484                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00329  
NADH dehydrogenase [EC:1.6.5.3]
K00356  
NADH dehydrogenase [EC:1.6.99.3]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rsph17029_2812
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Rsph17029_2812
   1.6.99  With other acceptors
    1.6.99.3  NADH dehydrogenase
     Rsph17029_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2962096..2963082)
Genome map
AA seq 328 aa AA seqDB search
MSKLVTIYGGSGFVGRYIARRMAQEGWRVRVAVRRPNEALFVKPYGVVGQVEPVFCNIRD
DASVRAVMHGADAVVNCVGILAESGKNRFQSVQAEGAARVARLAAAEGVQTLVQLSAIGA
DAQSPSAYGRTKAAGEAAVREAFPRAVILRPSVIFGPEDDFFNRFAQMTRFSPVLPVVGG
ATKFQPVFVDDVAQAAVAGVLGRAAPGTYELGGPDVETFRDLMKMLLRVVERRKLIVNVP
FWVANLIGGALDLVQTATFGLLANKTLTRDQVRNLRRDNIVAPDAKGLADLGISPTAMEA
VLPEYLWSFRPSGQYASIKASARNLRKT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcttgtgacgatctacggcgggtcgggcttcgtggggcgttacatcgcccgc
cggatggcccaggaaggctggcgcgtgcgcgtggccgttcgccgtccgaacgaggcgctg
ttcgtcaagccctacggtgtcgtggggcaggtggagcccgtcttctgcaacatccgcgac
gatgcctcggtgcgcgccgtcatgcacggcgcggatgcggtggtgaactgcgtggggatc
cttgccgaaagcggcaagaaccgattccagtcggtgcaggccgaaggcgcggcccgcgtg
gcgcggctcgccgctgccgagggcgtgcagacgctggtgcagctgtcggccatcggcgcc
gacgcgcagtcgccgagcgcctatggccgcaccaaagccgcgggcgaggccgccgtgcgc
gaggccttcccgcgggcggtgatcctgcgtccgtcggtgatcttcggacccgaggacgat
ttcttcaaccgcttcgcccagatgacgcgcttcagcccggtgctgccggtcgtcggcggc
gcgacgaaattccagccggtcttcgtcgatgacgtggcgcaggcggcggtggcgggcgtc
ctcggccgggcggcgccgggcacctacgaactgggcggcccggatgtggagaccttccgc
gacctgatgaagatgcttctgcgcgtggtcgagcggcgcaagctgatcgtgaacgtgccc
ttctgggtcgcgaacctgatcggcggcgcgctggatctggtgcagacggcgaccttcggg
ctgctggccaacaagaccctgacccgcgatcaggtgcgcaacctccgccgcgacaatatc
gtggcccccgacgccaagggcctcgccgatctcggcatctcgcccaccgcgatggaggcc
gtgctgccggaatatctctggagcttccggccgtcgggtcaatatgcctcgatcaaggct
tcggcgcggaacctgcgcaagacctga

DBGET integrated database retrieval system