KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2877Help
Entry
Rsph17029_2877    CDS       T00484                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rsph17029_2877
Enzymes [BR:rsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rsph17029_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3033662..3034516)
Genome map
AA seq 284 aa AA seqDB search
MLLNLGSINIDHVYRMPHLPAPGETLEAESYSVGLGGKGANQSVAAARAGARVLHVGAVG
PEGRWARDWMAAAGVDVTHVAVGEVATGHAIINVDEEAENTIVIFPGANRTLDAATVTAA
LAAAGPGDTLLLQNETSAQVEAARLAAERGLKVIYCAAPFEIGAVRAVLPYVSLLVMNEG
EAAALKAALGALPEVAMVVTLGARGAEWLVPGEDRLSVPAFPVTAVDTVGAGDCFTGNLA
AALDAGLDPAEAMRRASAAAALQVTRPGAAEAMPTADEVDAFLG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcaatctgggctcgatcaacatcgaccatgtctaccggatgccgcacctgccg
gcacccggagagacgctcgaggccgaaagctacagcgtgggtctcggcggcaagggagcc
aaccagtccgtcgccgcggcgcgggccggggcacgggtccttcatgtcggcgcggtcggg
cccgaggggcgctgggcgcgcgactggatggctgcggcgggcgtcgacgtgacccatgtg
gcggtgggggaggtcgccaccggccatgccatcatcaacgtggatgaagaggccgagaat
accatcgtgatcttcccgggcgccaaccggacgctcgatgcggccacggtgacggcggcg
ctcgccgcggcgggcccgggcgatacgctccttctgcagaacgagacctcggcgcaggtc
gaggcggcgcgtctggctgcggagcgcggcctgaaggtgatctactgcgccgccccgttc
gagatcggcgccgtgcgggccgttctgccctacgtcagcctcctcgtgatgaacgagggc
gaagcggcggcgctgaaagccgcgctgggggcgctccccgaggtggcgatggtcgtgaca
ctcggcgcccgcggtgccgaatggctcgtgccgggcgaggatcggctgtccgtcccggcc
tttcccgtgaccgccgtcgacacggtgggtgcgggcgactgtttcacgggaaaccttgcc
gcggcgctcgatgcggggctcgacccggcggaggcgatgcgccgggcatccgcggccgcc
gcgcttcaggtcacgcgtccgggcgcggccgaggccatgcccacggccgacgaggtggac
gccttcctcggctga

DBGET integrated database retrieval system