KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2942Help
Entry
Rsph17029_2942    CDS       T00484                                 

Definition
fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17029_2942
   01230 Biosynthesis of amino acids
    Rsph17029_2942
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17029_2942
   00030 Pentose phosphate pathway
    Rsph17029_2942
   00051 Fructose and mannose metabolism
    Rsph17029_2942
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17029_2942
   00680 Methane metabolism
    Rsph17029_2942
Enzymes [BR:rsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Rsph17029_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3097266..3098345)
Genome map
AA seq 359 aa AA seqDB search
MALITLRQLLDHAAERGYGVPAFNINNMEQGLAILAAARACDAPVILQASRGARSYAGDI
MLRHIVEALAEMYPQIPICLHQDHGNNEATCLSAIRHGFTSVMMDGSLQADMKTVASYDY
NVDITRRVTDAAHWVGASVEGELGVLGSLEKGEAEAEDGSGAEGKLDHSQMLTDPDQAVE
FVQATRVDALAIAMGTSHGAYKFSRKPDGEILAMRVIEEIHARLPATHLVMHGSSSVPQA
LQDLINAHGGEMPQTYGVPVEEIERGIRHGVRKVNIDTDCRMALTGQFRKVAMESPKEFD
PRKFMIPAMKEMEALVRDRFERFGTAGNASKITVIPMDDMAKRYASGALDPAVATAKAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatcacgctcagacaattgcttgaccatgccgcagagcgcggctatggcgtg
cccgccttcaacatcaacaacatggagcaggggctcgccatcctcgccgccgcccgcgcc
tgcgacgcgccggtgatcctgcaggccagccgcggggcgcggagctatgcgggcgacatc
atgctgcgccacatcgtcgaggcgctggccgaaatgtatccgcagatcccgatctgcctg
catcaggaccacggcaacaacgaggccacctgcctctcggcgatccggcacggcttcacc
tcggtgatgatggacggatcgcttcaggccgacatgaagacggtggcctcctacgattac
aacgtggacatcacccgccgcgtgaccgatgcggcccactgggtcggagcctcggtcgag
ggcgagctgggggtgctgggcagcctcgagaagggcgaggcggaggccgaggacgggtct
ggtgcggaaggaaagctcgaccacagccagatgctgaccgacccggatcaggcggtagag
ttcgtgcaggcgacccgcgtcgatgcgttggccatcgccatgggcacgagccacggcgcc
tacaagttcagccgcaagcccgacggcgagatccttgccatgcgcgtgatcgaggagatc
cacgcccggctgcccgcgacgcatctggtgatgcacggctcgtcctcggtgccgcaggcg
ctgcaggatctcatcaacgcccacggcggcgagatgccccagacctacggagtcccggtc
gaggagatcgagcgcggcatccgtcacggggtccgaaaggtcaatatcgacaccgactgc
cggatggccctgaccggccagttccgcaaggtcgccatggagagcccgaaggagttcgac
ccgcggaagttcatgatccccgcgatgaaggagatggaggccctcgtccgcgaccggttc
gagcggttcggcactgcgggcaatgcctcgaagatcaccgtcatcccgatggatgacatg
gccaagcgctacgcgagcggagcgctcgatcctgcggtcgcgaccgccaaagccgcctga

DBGET integrated database retrieval system