KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2942Help
Entry
Rsph17029_2942    CDS       T00484                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00010  Glycolysis / Gluconeogenesis
rsh00030  Pentose phosphate pathway
rsh00051  Fructose and mannose metabolism
rsh00680  Methane metabolism
rsh00710  Carbon fixation in photosynthetic organisms
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01120  Microbial metabolism in diverse environments
rsh01130  Biosynthesis of antibiotics
rsh01200  Carbon metabolism
rsh01230  Biosynthesis of amino acids
Module
rsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rsh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
rsh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rsh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
rsh_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17029_2942
   00030 Pentose phosphate pathway
    Rsph17029_2942
   00051 Fructose and mannose metabolism
    Rsph17029_2942
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17029_2942
   00680 Methane metabolism
    Rsph17029_2942
Enzymes [BR:rsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Rsph17029_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: ABN78044
JGI: Rsph170292942
UniProt: A3PNX8
Position
1:complement(3097266..3098345)
Genome map
AA seq 359 aa AA seqDB search
MALITLRQLLDHAAERGYGVPAFNINNMEQGLAILAAARACDAPVILQASRGARSYAGDI
MLRHIVEALAEMYPQIPICLHQDHGNNEATCLSAIRHGFTSVMMDGSLQADMKTVASYDY
NVDITRRVTDAAHWVGASVEGELGVLGSLEKGEAEAEDGSGAEGKLDHSQMLTDPDQAVE
FVQATRVDALAIAMGTSHGAYKFSRKPDGEILAMRVIEEIHARLPATHLVMHGSSSVPQA
LQDLINAHGGEMPQTYGVPVEEIERGIRHGVRKVNIDTDCRMALTGQFRKVAMESPKEFD
PRKFMIPAMKEMEALVRDRFERFGTAGNASKITVIPMDDMAKRYASGALDPAVATAKAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatcacgctcagacaattgcttgaccatgccgcagagcgcggctatggcgtg
cccgccttcaacatcaacaacatggagcaggggctcgccatcctcgccgccgcccgcgcc
tgcgacgcgccggtgatcctgcaggccagccgcggggcgcggagctatgcgggcgacatc
atgctgcgccacatcgtcgaggcgctggccgaaatgtatccgcagatcccgatctgcctg
catcaggaccacggcaacaacgaggccacctgcctctcggcgatccggcacggcttcacc
tcggtgatgatggacggatcgcttcaggccgacatgaagacggtggcctcctacgattac
aacgtggacatcacccgccgcgtgaccgatgcggcccactgggtcggagcctcggtcgag
ggcgagctgggggtgctgggcagcctcgagaagggcgaggcggaggccgaggacgggtct
ggtgcggaaggaaagctcgaccacagccagatgctgaccgacccggatcaggcggtagag
ttcgtgcaggcgacccgcgtcgatgcgttggccatcgccatgggcacgagccacggcgcc
tacaagttcagccgcaagcccgacggcgagatccttgccatgcgcgtgatcgaggagatc
cacgcccggctgcccgcgacgcatctggtgatgcacggctcgtcctcggtgccgcaggcg
ctgcaggatctcatcaacgcccacggcggcgagatgccccagacctacggagtcccggtc
gaggagatcgagcgcggcatccgtcacggggtccgaaaggtcaatatcgacaccgactgc
cggatggccctgaccggccagttccgcaaggtcgccatggagagcccgaaggagttcgac
ccgcggaagttcatgatccccgcgatgaaggagatggaggccctcgtccgcgaccggttc
gagcggttcggcactgcgggcaatgcctcgaagatcaccgtcatcccgatggatgacatg
gccaagcgctacgcgagcggagcgctcgatcctgcggtcgcgaccgccaaagccgcctga

DBGET integrated database retrieval system