KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3068Help
Entry
Rsph17029_3068    CDS       T00484                                 

Definition
exodeoxyribonuclease III Xth
Orthology
K01142  
exodeoxyribonuclease III [EC:3.1.11.2]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Rsph17029_3068
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     Rsph17029_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(81431..82198)
Genome map
AA seq 255 aa AA seqDB search
MRIATFNVNGVNGRLPVLLRWLEEARPDVVCLQELKAASARFPAAALEAAGYGAVWHGQK
SWNGVAILARGAEPVQTRQDLPGVQDGESRYIEAAVEGVLVGCLYLPNGNPAPGPKFAAK
LAWFDHLLNHAEELLRHDVPVVLAGDFNVMPTDLDVYRPERWREDALFRPEVRAAFARLL
AQGWTDSIRHLYPEDRIYTFWDYFRNAWERDAGLRLDHLLLSPSLLTRLKGAGVDRHVRG
WEKASDHAPAWIEIA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcgcgaccttcaacgtgaacggggtgaacggccggcttccggtgctgctgcgc
tggctcgaggaggcgcgccccgacgtcgtctgcctgcaggagttgaaggcggcctccgcg
cgctttccggccgccgcgctggaagctgcgggctacggggcggtgtggcacgggcagaag
agctggaacggcgtggcgatcctcgcgcgcggcgccgagccggtgcagacgcggcaggat
ctgccgggcgtgcaggacggtgaaagccgctatatcgaggcggcggtggagggcgttctc
gtgggctgcctctatctgccgaacggcaatccggccccgggcccgaagtttgccgccaag
ctcgcgtggttcgaccatcttctcaatcatgccgaggagctcctgcgccacgacgtgccg
gtggttcttgccggagacttcaacgtgatgccgaccgatctcgacgtctaccgtcccgag
cgctggcgcgaggacgcgctgttccgccccgaggtgcgggcagcctttgcccggcttctc
gcgcagggttggacagatagcatccggcatctgtatcccgaggatcggatctatacgttc
tgggactatttccgaaatgcgtgggagcgggacgccggtctgcggctcgaccatctgctg
ctgagcccgtcccttctgacccgtctgaagggggcgggggtcgaccggcatgttcgcggc
tgggagaaggcgagcgatcacgctccggcatggatcgagatagcctga

DBGET integrated database retrieval system