KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3270Help
Entry
Rsph17029_3270    CDS       T00484                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17029_3270
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17029_3270
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17029_3270
Enzymes [BR:rsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17029_3270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(333049..334278)
Genome map
AA seq 409 aa AA seqDB search
MAEDGINSYMTGPDEQGRFGIFGGRFVSETLMPLILDLEARYEHAKTDPDFWAEMDDLWK
NYVGRPSPLYFAPRLTEHLGGAKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGREVRWQLAEQEEGRLPDTLV
AAIGGGSNAMGLFHPFLDDPSVRIVGVEAGGKGVDDRMEHCASLTGGRPGVLHGNRTYLL
QDADGQILEGFSISAGLDYPGIGPEHAWLHDTGRAEYVSITDAEALEAFQLCCALEGIIP
ALEPSHALAHVIKIAPTLPRDHIIVMNMCGRGDKDIFTVAKHLGFDMKI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacggcatcaacagctacatgaccggccccgacgagcagggtcgtttcggc
atcttcggcggacgcttcgtgtccgagacgctgatgccgctgattctcgatctcgaagcg
cgctatgaacatgccaagaccgacccggatttctgggccgagatggacgacctgtggaag
aactacgtcggtcgtccctcgccgctctatttcgcgccgcggctgaccgagcatctcggc
ggggcgaagatctatctcaagcgcgacgagctgaaccataccggcgcgcacaagatcaac
aatgtgctgggccagatcatcctcgcccgccgcatgggcaagacccggatcatcgccgag
acgggcgcgggccagcatggcgtggcgacggcgacggtctgcgccaagttcgggctgaaa
tgcgtggtctacatgggcgcgcacgatgtcgagcggcaggcgccgaacgtgttccgcatg
cggctgctgggcgccgaggtggtcccggtgacctccgggcgcggcacgttgaaggatgcg
atgaacgacgccctgcgcgactgggtcaccaacgtgcgcgacaccttctactgcatcggc
accgtggcgggcccgcatccctatccggcgatggtgcgcgacttccagtcgatcatcggc
cgcgaagtgcgctggcaactggccgagcaggaggagggccgcctgcccgacacgctcgtg
gccgcgatcggcggcgggtcgaatgccatggggctgttccatccgttcctcgacgatccg
tcggtgcggatcgtcggcgtcgaggccgggggcaagggcgtcgacgaccggatggaacat
tgtgcctcgctgaccggcggacgtccgggcgtgctgcacggcaaccggacctatctgctg
caggatgccgacggccagatcctcgagggcttctcgatctcggccgggctcgattatccg
ggtatcgggcccgaacatgcgtggctccatgacacgggccgggcggagtatgtgtcgatc
accgatgccgaagcgctggaggcgttccagctctgctgtgcgctcgaagggatcattccc
gcgctcgagccgtcgcacgcgctggcccatgtcatcaagatcgcgccgacgctgccgcgc
gaccatatcatcgtgatgaacatgtgcgggcggggcgacaaggacatcttcaccgtggcg
aagcatctgggcttcgacatgaagatctga

DBGET integrated database retrieval system