KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3286Help
Entry
Rsph17029_3286    CDS       T00484                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rsph17029_3286
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rsph17029_3286
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rsph17029_3286
Lipid biosynthesis proteins [BR:rsh01004]
 Fatty acid synthase
  Component type
   Rsph17029_3286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(348996..349622)
Genome map
AA seq 208 aa AA seqDB search
MALALVFSAMPAAAAEEVTVLALGDSLTAGYGLPEGEGFVPQMQQWLREHGESVSLVNAG
VSGDTTAGGRARLDWSLTPEVDAMIVNLGGNDMLRGLDPALTRGNLEAILKTAEDRGLPV
LLVGLAAPGNYGPDFKRSFDAIFPGLAQSYGADLEPNFFAALAARLDEPDARQRYMQPDG
IHPSAEGVAVIVEEMGPRVQALVERARQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggccctcgtcttctcggccatgcctgccgccgcggccgaggaggtcacggtg
ctggcgctcggcgacagcctgacggcgggctacggcctgcccgagggcgagggcttcgtg
ccgcaaatgcagcaatggctgcgggagcatggcgagagcgtctcgctggtgaatgccggc
gtctcgggcgacacgacggcgggcggccgcgcgcggctcgactggagcctgacgcccgag
gtcgatgccatgatcgtgaaccttggcggtaacgacatgctgcgcggcctcgatccggcg
ctgacgcgcgggaacctcgaggcgatcctgaagacggccgaggaccgcgggctgccggtg
cttctggtcgggctcgcggcgccgggcaattacggccccgacttcaagcggtcgttcgat
gcgatctttcccggtctggcccaaagctacggcgcggatctggaaccgaacttcttcgcc
gcccttgccgcacggctggacgagcccgacgcgcgtcagcgctacatgcagcccgacggc
atccatccgagcgccgagggcgtggccgtgatcgtcgaggagatggggccgcgcgtgcag
gcgctggtcgagcgtgcgcggcagtag

DBGET integrated database retrieval system