KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3474Help
Entry
Rsph17029_3474    CDS       T00484                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rsph17029_3474
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Rsph17029_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(552109..553071)
Genome map
AA seq 320 aa AA seqDB search
MSVLPTDSLSTPRFVGLPSFMRLPMATELQGLDAAIVGLPSDSGAPFRTGARFAPNALRA
MSVMLRPINPYRGHINIFEVLRVADAGDATCVPGYEIESLAALERALDAVVEAGAVPFGI
GGDHSVSLAGLRAAAKRHGPLGLVHFDSHTDTWDSYFDGKRYSAGTMFRRAIEEGIVDPA
RSIQVGMRGSLFQPADVSQSVDLGLEVITCDEMFALGLPETARRIAARSAGHPAFLSFDL
DFVDPAYAPGVETPECGGPTARETLSLLRSLQGLNLVGCDVVELNPSYDGPGQITALLGA
TVMAELLAILAEARVRERSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctgcccacagactcgctctccaccccccgcttcgtcggcctgccgagcttc
atgcgcctgcccatggccaccgagcttcaggggctcgacgccgccatcgtcggcctgccc
tcggattcgggcgcgcccttccgcaccggcgcgcgcttcgcgccgaacgcgctgcgggcc
atgtcggtgatgctgcgcccgatcaacccctatcgcggccacatcaacatcttcgaagtc
ctgcgcgtggccgatgcgggcgacgcgacctgcgtgccgggctacgagatcgagagcctc
gccgcgctcgaacgggcgctcgacgcggtggtcgaggccggcgcggtgcccttcggcatc
gggggcgaccactcggtctcgcttgccggtctccgggcggcggccaagcgccacgggccg
ctcggcctcgtgcatttcgacagccacaccgacacctgggacagctacttcgacggcaag
cgctacagcgccggcaccatgttccgccgcgccatcgaggagggcatcgtcgatcccgcc
cgctcgatccaggtggggatgcgcggctcgctgttccagccggccgatgtcagccagtcg
gtcgatctcggtctcgaggtcatcacctgcgacgagatgttcgcgctgggattgcccgag
accgcccgccggatcgccgcgcgcagcgcaggtcacccggccttcctgagcttcgatctc
gatttcgtggatcccgcctatgcgcccggcgtcgagacgcccgagtgcggcggccccacc
gcgcgcgagacgctctcgctgctgcgcagcctccagggcctcaacctcgtcggctgcgac
gtggtcgagctcaatccttcctatgacggtccgggccagatcaccgccctgctcggggcc
accgtcatggccgagcttctggcgatcctcgccgaggcgcgggtccgcgagcggtcacga
taa

DBGET integrated database retrieval system