KEGG   Runella slithyformis: Runsl_0072Help
Entry
Runsl_0072        CDS       T01553                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsi  Runella slithyformis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Runsl_0072
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Runsl_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(88954..89763)
Genome map
AA seq 269 aa AA seqDB search
MITFPNAKINIGLHITEKRSDGFHNLESCFYPVGWSDVLEVIPATEFSFSSSGIDIPGDP
AKNLCVKAYELLKKDFSLPPLSMHLLKIVPIGAGMGGGSSDAAFTLSLLNQVYDLKLSTE
ALENYARTLGSDCAFFIQNKPVYCYEKGDRFADIPLSLQGKYIVLVYPNLHISTAEAYAG
VKPQAPKVNLLEALQRPPAEWRHSIQNDFEKGLFEKYTVLPELKAKMYALGAEYAAMTGS
GSTIYGIFEKEVDLQNNFNQYTVWKGELL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgattactttccccaacgccaagatcaacattggcctgcacattaccgaaaaacgctcc
gacggttttcacaacctcgaatcctgtttttatcccgttggctggagtgatgtactggag
gtgattcccgccactgagttcagcttctcttcttcagggattgatattcccggcgaccct
gccaaaaatctctgcgtgaaagcgtacgaattgctcaaaaaggacttttcgctgcctccg
ttgtcgatgcacctgcttaagatcgttccgatcggggccggtatgggtggaggctcttcc
gatgcagcctttacactttcgctgctgaatcaggtatatgacctgaaactctccactgaa
gcgttggaaaactacgcccgaacgctggggagcgactgcgccttttttattcaaaacaaa
cccgtttattgctacgaaaaaggcgaccggtttgccgatattccgctttcgctccaagga
aaatacattgtgttagtataccccaaccttcatatctctaccgccgaagcctacgccggc
gtgaaaccccaagccccaaaggtaaatttattggaagccttgcaacgcccgccggcagaa
tggcgtcatagtatacagaatgattttgaaaaaggactgtttgagaaatacacagttttg
cccgaactaaaggctaaaatgtacgcattgggggccgagtatgccgccatgacgggttca
gggtcgaccatttacggtatttttgagaaagaggtcgatttgcagaacaatttcaatcaa
tacaccgtttggaaaggagagttattatag

DBGET integrated database retrieval system