KEGG   Runella slithyformis: Runsl_0094Help
Entry
Runsl_0094        CDS       T01553                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rsi  Runella slithyformis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Runsl_0094
   01230 Biosynthesis of amino acids
    Runsl_0094
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Runsl_0094
   00030 Pentose phosphate pathway
    Runsl_0094
   00051 Fructose and mannose metabolism
    Runsl_0094
   00052 Galactose metabolism
    Runsl_0094
  Energy metabolism
   00680 Methane metabolism
    Runsl_0094
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Runsl_0094
Protein phosphatases and associated proteins [BR:rsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Runsl_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
122331..123308
Genome map
AA seq 325 aa AA seqDB search
MIKKIAVFTSGGDAPGMNACIRAVVRTSMYYGIEVYGIRRGYNGMIAGDIYQMTSHSVSN
IIQRGGTILKSARSKEFMTKEGRQKAFEQLQKFGIEGLVAIGGNGTFTGATIFYDEYGIP
TVGAPGTIDNDLFGTDYTIGYDTAVNTALEAIDKIRDTADSHDRVFFIEVMGRDSGYIAI
QSGIAGGAEIVMVPEVLTPITEVIETLKQGWNRSKSSSIIVVAEGDEEGNAAEVAEKIKS
RVDIDIDIRVTTLGHIQRGGIPTAYDRILASRLGLGAVEGLMNGHKNVMVGIINNEIIYT
PFRDTIRLPKPINEDMLRMVKILST
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattgcggtttttacctcaggcggagacgctcccggtatgaacgcttgc
atccgcgccgtagtccgtacttccatgtattatggaattgaagtatatggtatccgtcgc
ggttacaatggaatgattgccggtgacatttatcagatgacttctcattctgtaagcaat
ataattcagcgtggcggtaccattcttaaatcggcccgcagcaaagaatttatgactaaa
gaaggtcgtcaaaaagcatttgaacaactccaaaaattcggaatcgaaggacttgttgcc
attgggggaaacggaacgtttacgggcgccactattttttacgacgaatacggcatccct
accgtaggtgccccgggaaccatcgacaatgacctcttcggcactgactataccattggt
tatgataccgccgttaatacagccctggaagccattgacaaaattcgcgatactgctgat
tctcacgaccgcgttttctttatagaagtaatgggccgcgactccggctacattgccatt
caatcaggcattgcgggcggggctgaaatcgtgatggttcctgaagtattaacccccatt
acggaggtaatcgaaaccctcaagcagggctggaaccgctcaaagtcttcttctatcatt
gtagtagccgaaggagatgaagaaggtaacgccgccgaagtagccgaaaaaatcaaatca
cgggttgatatcgacattgatattcgcgtaacgacccttgggcacattcagcggggtgga
atcccaaccgcgtatgaccgcatattggccagccgtttgggactcggagccgttgaaggt
ctcatgaacggtcataaaaatgtcatggttggaatcattaataacgaaatcatatacact
cctttcagagatacgatccggttgcctaaacccatcaacgaagatatgcttcggatggtg
aaaattctcagtacatag

DBGET integrated database retrieval system