KEGG   Runella slithyformis: Runsl_0111Help
Entry
Runsl_0111        CDS       T01553                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rsi  Runella slithyformis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Runsl_0111
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Runsl_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
147545..149602
Genome map
AA seq 685 aa AA seqDB search
MDKVRRKSESVNKPIISMKTKYIINILTASALLAGSYGCKPDNSGKSGGSELAGDAAQKV
YVAPGKHDEFYNIVSGGFNGQLSVVGLPSGRVLRIIPVFSQFAENGWGYSEETKPMLNTS
HGFVPWDDSHHVALSTTNGEHDGKWAFINGNNTPRIARISLSTFRTDEIIEIPNSGGNHS
SPFITANSEYAVAGTRFSVPPDANADVSISSFKQNFKGYISFVSIDKTTGHMAIKFQLKT
PGVSFDLSRAGKGKSDGWFFFSCYNTEQANSLLEVNASQKDKDFILAVNWKKAEQYLAQG
KGKKEPAKYAHNVYDEKTHSATSTILNEVMTLDPKECPDMLYFIPCPKSPHGCDVDPTGS
FIVGSGKLAAVIPVFSFDKIQKAIAAKTFDGSFDGIPVLKYEAVLHGEVKKPGLGPLHTE
FDGQGNAITSFFVSSELVKWNLQTLEVLDRVPTYYSVGHLSIPGGPTSKPHGKYVIAYNK
ITKDRYLPTGPELTQSAQLYDISGEKMKLLLDFPTIGEPHYAEAIPASLVEKNSRKIFKL
EENFHPYVAKGEKEAKVVRKGNEVHVYMTAIRSHFTPDNIEGVRMGDDVYFHVTNLEQDW
DVPHGFAVRGANNAEILIMPGETCTLKWKPTKVGVTPMYCTDFCSALHQEMQGYVRVSPA
GSKIPLSWGTGKNPTAEAEKKVAKL
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
gtggataaagtcagacgaaagtcagaatcagtaaacaaaccgattatttcaatgaaaact
aaatacattatcaacatcttaacagcctctgctttactggcagggagttacggctgtaaa
cccgataattcgggaaaatccggcggttcggaattagccggcgatgccgcccaaaaagtg
tacgtcgcaccgggcaagcacgacgagttttataacatcgtatcgggcgggttcaacggc
caactttcggtcgtaggattgccttcgggccgggtgttgcgcattattcccgttttctcc
caatttgccgaaaacggttggggctacagcgaagaaaccaaacccatgctcaatacctcg
cacggatttgtgccttgggacgactctcaccacgtggccctttcaaccaccaatggcgaa
cacgacggcaaatgggcgtttatcaacggcaacaacacgccgcgcattgcccgcatcagt
ctttcgaccttccgtaccgacgaaatcatcgaaatccctaactcgggcggcaaccactcc
tctcctttcattacggccaactccgagtacgccgtggccggcactcggttttcggtaccg
ccggatgccaacgccgacgtatccattagcagttttaagcaaaactttaaaggttacatc
agttttgtgagcatagataaaaccacgggacacatggccattaagtttcagttaaaaacc
cccggcgtaagctttgatttgtcccgcgccggaaaaggcaaatccgacggttggtttttc
ttctcgtgctacaacaccgagcaggccaattctttgctggaagtaaacgcttcgcaaaaa
gacaaagactttattttggctgtcaactggaaaaaagccgagcagtatttagcccaaggc
aaaggcaaaaaagagccggccaagtatgcccacaacgtctacgacgaaaaaacgcattcg
gctacctcaaccatcctcaacgaagtaatgacgctcgaccccaaagagtgtccggatatg
ctctattttataccttgtcctaaatcgccccacggttgtgacgttgaccccacgggcagc
tttattgtaggctcaggaaaattggccgccgtcattcccgtcttttcgtttgacaaaatt
caaaaagcgattgcggccaaaacattcgacggcagctttgacggaattccggtgctgaaa
tacgaagcggtattgcacggagaagtgaaaaagcccggcttagggcccctgcacaccgaa
tttgacggacagggcaatgcgatcacgtccttctttgtttcgtctgaattggtgaaatgg
aacctccaaaccctcgaagtgctcgaccgcgtgcccacttactattccgtaggccacttg
tctatccccggcggaccgacttccaaaccacacggaaaatacgtgatcgcgtacaacaaa
atcacgaaagaccgctacctgcctacgggccccgaattgacccaatcggcgcagttgtac
gacatttcgggcgagaaaatgaagctgttgcttgacttccctaccattggtgagccgcac
tatgccgaagccattcccgcttcattggtcgaaaaaaactcacggaagatctttaaattg
gaagaaaacttccacccttacgtagccaaaggcgaaaaagaagccaaagtagtgcgcaaa
ggcaacgaagtccacgtgtacatgaccgccatccgctcgcactttacacccgacaatatt
gaaggcgtacgaatgggcgacgacgtttatttccacgttaccaacttggaacaggactgg
gacgttccgcacggttttgcggtacgcggggccaataatgccgaaatcctcatcatgccc
ggcgagacctgtaccctcaaatggaaacccaccaaagtaggcgtgacgcccatgtactgc
accgatttttgttcggcgctccaccaggaaatgcagggatacgttcgcgtttcacccgcc
ggcagcaaaatccccctctcgtggggaacgggcaaaaacccgactgccgaagcggaaaag
aaagtggctaaactgtaa

DBGET integrated database retrieval system