KEGG   Runella slithyformis: Runsl_0181Help
Entry
Runsl_0181        CDS       T01553                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsi  Runella slithyformis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Runsl_0181
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Runsl_0181
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Runsl_0181
Lipid biosynthesis proteins [BR:rsi01004]
 Desaturase
  First
   Runsl_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
222136..222888
Genome map
AA seq 250 aa AA seqDB search
MYILVFFVAHWYLSLLMQTFFLHRYAAHKMFTMSPFWEKFFYTLTFIFQGSSFLSPYAYG
VMHRLHHAYADTEEDPHSPSFSSSLMDMMWKTKNYYNNILHREDTIPAKFKKDVPHWAFI
ERLGDYWFIRIAWGTLYVLFYIQFATAWWMFLLLPIHFLMGPVHGVIINWYAHKYGYTNF
KVNDTAKNLLPFDFLMMGESYHNNHHKLGGRANFGVKWHEFDPTYPFILFLNATGIIKLK
RNNDLNYMPQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacattcttgtatttttcgtagcccattggtatttatcactcctgatgcaaaccttc
tttctgcatcgttatgccgctcacaaaatgtttaccatgagtccgttctgggagaagttt
ttttatacccttacctttatatttcaaggctcttcttttctaagcccctacgcgtacggc
gttatgcaccgcctgcaccacgcctatgctgataccgaagaagacccacactcaccgagt
ttttcgtcgagtttgatggatatgatgtggaaaacaaagaactactacaacaatatcctt
caccgcgaagatacaattcctgccaaatttaagaaggatgttccgcactgggcgttcatc
gaacgattgggtgactattggtttatccgcattgcttgggggacattatacgttttattt
tacattcagttcgctacggcctggtggatgtttttgctgctgcccattcacttcctgatg
ggccccgttcacggggtgatcatcaactggtatgcccacaaatacggctatacaaatttc
aaagtcaacgacaccgccaaaaacctgctgccctttgactttctgatgatgggcgaatcg
taccacaacaaccaccataaactgggaggacgtgccaacttcggtgtaaaatggcacgaa
tttgatccaacgtatccgttcattttattcctcaatgccaccgggatcatcaaactgaaa
cgaaacaacgacctcaactatatgcctcagtaa

DBGET integrated database retrieval system