KEGG   Runella slithyformis: Runsl_0196Help
Entry
Runsl_0196        CDS       T01553                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsi  Runella slithyformis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Runsl_0196
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Runsl_0196
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Runsl_0196
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Runsl_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(238743..240044)
Genome map
AA seq 433 aa AA seqDB search
MILYSTKNRQLKANLEEAVFRSLPADNGLYMPEHIPTVSEEFLKNIDQLTFNEIAFEVSK
SLLNEDIPENDIRMIVERAFDFDAPVVPIEVNIRCLELFHGPSMAFKDFGARFMASLMSY
FLGRSQKEIHILVATSGDTGGAVAQGFHNVPGISVTILYPKGKVSDIQEKQLTTLGGNVT
ALEVEGTFDDCQALVKQAFLDKELTQKYNLASANSINISRLIPQSFYYFRAYAQVKHLGL
PVVFSVPSGNFGNLSAGILAHRMGLPVDHFVAVTNRNNVVPKYLENGAYTPSPSVETVSN
AMDVGNPSNFVRLTRFFDDEWSQVKNDVSGFWFNDEQTKAAMQDVYERQGYLMCPHTAVA
YLGLKEYMNLINKEVLGVFLSTAHYAKFLNVVEDALGTAEVNIPTRLSVLLSKTKESIPM
STRFEDFKNYLLS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattttatacagtacgaagaatcgacagcttaaagctaatcttgaagaagcggtattt
cggagtcttccggctgataatggattatatatgcctgaacatattccgacggtgtcggag
gaatttctgaaaaatattgatcaattgacatttaacgaaattgcgttcgaggtttcaaaa
tccttgttgaatgaggatattcctgaaaatgatatccggatgatcgtggagcgagccttt
gattttgatgctccggtggttccgattgaagtcaatatccggtgcctcgaactttttcat
ggcccttccatggcatttaaagattttggagcccgtttcatggcgtcactgatgtcttat
tttttggggcgctcgcaaaaagaaatacatattctggtagctacgtccggtgatacaggc
ggtgcggtagctcaggggtttcataatgtgcccggtataagtgttacgattttataccca
aagggaaaagtaagtgatattcaggaaaaacaattaacaacactgggtggaaatgtgacg
gcgttggaagtcgagggtacgtttgatgattgtcaggcgctggttaaacaggcgtttttg
gacaaagaattaacgcaaaagtataaccttgcctctgcgaactccatcaatatttcgcga
ttgattccgcagtctttttattatttcagagcctatgcacaagtaaaacacctagggctt
cccgttgtgttttcagtcccgagcggtaatttcggaaatctgagcgcgggaattttagcc
catcgtatggggcttcccgtggatcattttgtggccgttacgaatcgtaataatgttgtt
cccaagtatttggaaaatggagcctatacaccttcaccttcggtagaaacagtttcaaat
gcgatggacgtaggtaatcccagcaattttgtgcgcctgacccgctttttcgacgatgaa
tggagccaagtgaaaaacgatgtgtcaggtttttggtttaatgacgaacagaccaaagcc
gctatgcaggatgtgtatgagcgtcaggggtacctgatgtgtccgcatactgctgtcgcc
tatttagggttgaaagaatatatgaatttaatcaataaagaagtattaggtgtctttttg
tcaacggcgcattatgccaagtttcttaatgtggtagaagatgcccttggtaccgcagaa
gtgaacattcctacccgtttgtcagtgctgttgagcaaaaccaaagaatcaattccaatg
agcactcgctttgaggattttaaaaattatctactttcatag

DBGET integrated database retrieval system