KEGG   Runella slithyformis: Runsl_0533Help
Entry
Runsl_0533        CDS       T01553                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsi  Runella slithyformis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Runsl_0533
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Runsl_0533
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Runsl_0533
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Runsl_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
630746..632116
Genome map
AA seq 456 aa AA seqDB search
MAEKQYKILLSEDEIPRHWYNIQADMPNKPLPPLHPGTKQPVGPADLAPLFPMELIKQEV
SQERYIEIPEEVREIYKLWRPTPMFRAHRLEKMLDTPAKIYYKYEGVSPSGSHKTNTAVA
QAYYNKMEGVKRITTETGAGQWGTALAIACQMFGIECEVFQVRISYNQKPYRKALIESFG
AKIYPSPSELTESGRKILAQYPDTPGSLGIAISEAIECAVQDESCKYALGSVLNHVLMHQ
TIIGQECLVQMEKAGDFPDIVIAPLGGGSNFAGISFPFLHQNITRGKKVRAIAVEPASCP
KLTKGEFRYDFGDSAGFTPLLPMYTLGHNFRPAAIHAGGLRYHGASVLCSQLLKDGLIEA
NAIQQLECFETGVAFAKAEGIIPAPEATHAIAQVFREAQRCKEEGKSETILFNLCGHGFL
DMQAYMDYFDGKLADHFLTEEELKSGLKELEGYPSI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaacagtataaaatcttattgtcggaagacgaaattccgagacattggtac
aacattcaggcagacatgcccaacaaaccgcttccgccactgcatccgggaacgaagcag
ccggtaggtccggccgacttagcgccgttgtttccgatggaactcatcaagcaggaagtc
tcgcaggaacgttacattgaaattcccgaagaagtccgtgagatctacaaattatggcgt
cccacgccgatgttccgggcgcaccgtctggagaaaatgctggatacgcccgccaagatc
tactacaaatacgaaggtgtaagtccatcgggcagccacaaaaccaacacggcggtggcg
caggcgtattacaacaaaatggaaggcgtcaagcgcatcaccaccgaaaccggtgccgga
cagtggggcacggccctggccattgcgtgtcagatgttcggtattgagtgtgaggtcttt
caggtacgcatcagctataaccaaaagccgtatcgcaaagcgctgatcgagtcatttggg
gccaaaatttacccttcaccttctgagttgaccgaatcgggacgcaaaatattggcgcag
tatcccgatacaccgggcagtttgggcattgccatttccgaggccatcgaatgtgccgta
caggacgaaagctgcaaatatgccctcggcagcgtgctgaaccacgtattgatgcaccaa
accatcatcggacaggagtgtctggtgcaaatggaaaaagccggcgattttccggacatc
gtcattgcgccgttgggcggtggttccaattttgcgggaatctcgtttccattcctgcac
caaaatattacgcgaggcaaaaaagtgcgcgccattgcggtagagccggcgtcgtgcccc
aaattgaccaaaggcgaattccgctatgatttcggcgactcggcgggcttcacgccgttg
ttgccgatgtacaccttaggccacaatttccgtcctgccgccattcacgcgggtggattg
cgctaccacggtgcctcggtgctttgttcgcaactgttgaaagacggtctgatcgaagcc
aatgccattcagcaattggaatgctttgaaacgggtgtcgccttcgccaaagcggaagga
attatccccgctcctgaagccacgcacgccattgcgcaggtattccgcgaagcccagcgt
tgcaaagaagaaggaaaatcagagaccattttattcaacctctgcggacacggtttcttg
gacatgcaggcgtacatggattatttcgacggaaaactcgccgaccacttcctgaccgaa
gaagaactgaaatcggggctgaaagagttggaaggctatccaagtatttaa

DBGET integrated database retrieval system