KEGG   Runella slithyformis: Runsl_0663Help
Entry
Runsl_0663        CDS       T01553                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rsi  Runella slithyformis
Pathway
rsi00010  Glycolysis / Gluconeogenesis
rsi00030  Pentose phosphate pathway
rsi00051  Fructose and mannose metabolism
rsi00052  Galactose metabolism
rsi00680  Methane metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01200  Carbon metabolism
rsi01230  Biosynthesis of amino acids
Module
rsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Runsl_0663
   00030 Pentose phosphate pathway
    Runsl_0663
   00051 Fructose and mannose metabolism
    Runsl_0663
   00052 Galactose metabolism
    Runsl_0663
  Energy metabolism
   00680 Methane metabolism
    Runsl_0663
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Runsl_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEI47106
UniProt: F8EH78
Position
791216..792145
Genome map
AA seq 309 aa AA seqDB search
MNIVTLTVNPAVDKSTIIDRLIPEQKLRCDPPRFDAGGGGINVSKAIRRLGGKSLAIFTA
GGLPGQLLAKLVRQEQIDAKIIETAEWTRENFVVSETSTNAQYRFGMPGAALSETETQAI
LEALEQSEADYIVASGSLPPHMDVNFYEKVAEISKNIGARLILDTSGEPLRAACDEGVFL
LKPNIGELEALVGTSNLETDDVDDAARSLIGDGKCEVVIVSLGPKGAILVTKDLCEHIPA
PPVQKRSTVGAGDSMVAGMTWALTQGLSYPDMLRWGVACGSAATMNEGTQLFLRADVERL
LEWLKRFGN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtcaccctgaccgtcaatccggccgttgataaaagcacaatcatcgaccgt
cttattcccgaacaaaaacttcgatgcgacccaccccgttttgacgcaggcggcggcggc
atcaacgtctccaaagccatcagacgattgggcggaaaatcattggccatttttacggcc
gggggcttaccgggccaactattggctaagctggtcagacaggaacaaatcgacgccaag
atcatcgaaacggcagaatggacacgggagaattttgtcgtttccgaaacctccaccaac
gctcagtaccgatttggaatgcccggtgcagcactcagtgagaccgaaacgcaggccatt
ttggaggcgctggagcaatctgaggccgattacatcgtggccagcggcagtttgcccccg
cacatggacgtaaatttttacgaaaaagtagccgaaatttctaaaaatatcggtgcccga
ctcatcctggacacgtcgggtgagccgctccgcgccgcgtgcgatgaaggcgtttttttg
ctcaagcccaacatcggcgaactggaagccctggtaggcacgtccaaccttgaaacagac
gacgtagacgatgccgcccgcagcctcatcggcgacggcaaatgcgaagtggtgatcgtt
tctctgggacccaaaggcgctattttggtaaccaaagacctgtgtgaacacatcccggcc
ccacccgtacaaaaacgcagtaccgtgggggccggcgacagcatggtggccggcatgaca
tgggccctgacgcaggggctttcgtatccggatatgcttcgctggggcgtggcctgcggc
tcggccgcgaccatgaatgaaggcactcaactttttctgcgggccgatgtcgaacgcctg
ctggaatggttaaagcgattcgggaactaa

DBGET integrated database retrieval system