KEGG   Runella slithyformis: Runsl_0780Help
Entry
Runsl_0780        CDS       T01553                                 

Definition
Mg-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rsi  Runella slithyformis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Runsl_0780
Enzymes [BR:rsi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Runsl_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
919798..921315
Genome map
AA seq 505 aa AA seqDB search
MTYRELKSKQLLKIHTLGELKAAGYQPKSIKQELRDNLIEKLRAKESVFPGIWGYEETVI
PDVERAILSMHHINLLGLRGQAKTRIARLMVNLLDEYIPVVTGSDLNDDPLQPLSRFARD
IVAEKGDDTPISWLHRDDRYAEKLATPDVSIADLIGDVDPIKAATLKLPYSDERVIHFGL
IPRSHRCIFVINELPDLQARIQVSLFNILQEGDIQIRGFKLRLPLDIQFVFTANPEDYTN
RGSIVTPLKDRIDSQIVTHYPKSLEIGRKITEQEAIVKTEQKGMVKTNEIIKDLIEQIAF
EARESEYVDSKSGVSARLTIAAYENLLSAAERRVLMNGEKETYVRISDLYGVVPAICGKV
ELVYEGEVEGPVIVAQNLIGKAIRTQFLNYFVNPESLKKKKAAKNPFQKIQDWFGENEMD
ILSGLSNREYEARLRTIEGLDDLVDDFHRGLSREEKLFLMEFALHGMAEYSLIGKQTLDN
GLHFKDLLGSMFSGPDAEDDDDDVF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcgtgagttgaagtctaaacaacttctcaagatccacacgcttggagaatta
aaggccgcaggttatcagccaaaatccattaaacaggagttaagagacaatctgattgaa
aaattacgggcaaaagagtcggttttccccggcatttgggggtatgaagaaacggttatt
cctgacgtggaacgggccattttgtccatgcatcacatcaacctgctgggtttaagagga
caggcgaagacgcgtattgcacgattgatggtcaatttattggatgaatacattccggtc
gtgaccggctccgacctcaacgatgaccctttgcaaccgctttcacgctttgcacgggat
attgtcgctgaaaaaggtgacgacactcctatttcatggctgcaccgcgacgaccgctac
gccgaaaaactcgccacgcccgacgtctccattgccgacctgatcggggatgtagacccc
atcaaagccgccacgctcaagctgccgtattcggatgagcgcgtgattcacttcggcctt
attccgcgatcgcatcgctgtatctttgtcatcaacgagctccctgacttacaggcccgt
attcaggtatctctttttaatattttacaggaaggcgacattcagattcgcggttttaaa
ctgcgtttgcccctcgatattcaatttgtatttacggccaatcccgaagattataccaat
cgcggcagcatcgtcacaccgctgaaagaccggattgacagtcagatcgtgacccactat
cctaagtcgctggaaataggtcggaagatcaccgaacaggaggccattgtcaagaccgag
cagaaaggcatggtcaaaaccaatgagatcatcaaagacctgatcgagcagattgccttt
gaagcccgcgaaagtgagtacgttgattccaaaagcggggtatcggcgcgtttaacgatt
gccgcttacgagaacctgctctcggccgccgagcgacgggtgcttatgaatggcgaaaaa
gagacctacgtacgtatttctgatctgtacggtgtggttccggccatttgcggtaaagtg
gaactggtctatgaaggcgaagtggaaggtccggtcatcgtggcccaaaacctgatcgga
aaggccattcgtacccaattcctgaactactttgttaatccggaatcgctgaagaagaaa
aaagcggcaaaaaaccctttccaaaaaattcaggattggtttggcgaaaacgaaatggat
attttgagtggcctcagcaaccgggagtatgaagcccgcttacgcacgattgaaggcctc
gacgacttggtagatgacttccaccgcggactgagccgcgaggagaagctgttcttaatg
gaatttgccctgcacggcatggccgaatattcactcatcggcaaacagaccttagacaac
ggccttcatttcaaggacctgctcggcagtatgttttccggccctgatgccgaagacgat
gacgacgatgtattttaa

DBGET integrated database retrieval system