KEGG   Runella slithyformis: Runsl_0917Help
Entry
Runsl_0917        CDS       T01553                                 

Definition
aspartate 1-decarboxylase
Orthology
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
rsi  Runella slithyformis
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:rsi00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:rsi00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1085041..1085391
Genome map
AA seq 116 aa AA seqDB search
MFLTLLKSKIHRVKVTQAELNYVGSITIDEELMEAAGILENEQVHIVNNNNGERLITYVI
KGARGTGIICLNGAAARKAQVGDVIIIISYVMMTEEEARTFKPTLVFPDENNKPVR
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcaccttactcaaatcaaaaattcaccgcgtaaaggtcactcaggctgagctg
aattacgtaggcagcattacgatcgacgaagagcttatggaggctgccggcattcttgaa
aacgaacaggtacacattgtcaacaataacaacggcgaacgactgatcacctatgttatt
aaaggcgcacgcggcacaggcatcatatgcctcaacggcgcggccgcccgcaaagcgcag
gtaggcgatgtgatcattatcatttcatacgttatgatgaccgaagaagaagcccgaacg
tttaaaccaacactcgtttttcccgacgaaaacaacaaaccggtacgatag

DBGET integrated database retrieval system