KEGG   Runella slithyformis: Runsl_1032Help
Entry
Runsl_1032        CDS       T01553                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rsi  Runella slithyformis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Runsl_1032
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Runsl_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1211226..1211792
Genome map
AA seq 188 aa AA seqDB search
MEGKLIIFSAPSGSGKTTIVRHLLSKYNNLGFSISACTRDRRGRNEVHGKDYYFLSPDEF
KQRIDNNEFVEWEEVYPGGYYGTLKSEIERLWSEGKHVIFDVDVKGGLKLKEYFGERALA
IFVKAPSEEAIKERLMMRGTETEDSLSKRLFKVKFEMSFQDQFDVILINDRLETALAKAE
ELVENFLG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttggaaggaaagctcatcatcttctctgccccatcaggctccggaaaaacgaccatcgta
cgacacctgctctcaaagtacaacaatctgggcttttccatttctgcctgcacccgcgac
cgccgtggccgcaatgaagtccacggaaaagattactacttcttaagcccggatgaattt
aaacaacgcattgacaacaatgagtttgtggagtgggaagaagtctacccgggcggttat
tacggcacgcttaaatctgagatcgaacgcttatggtcagaaggaaagcatgtcattttt
gacgtggatgtgaagggcggccttaagctgaaagaatactttggagaacgggctctcgcc
atctttgtgaaggcaccgagcgaagaggctatcaaagaacgcctcatgatgcgcggtacc
gagaccgaagacagcctttccaagcggctgtttaaagtaaaatttgagatgtctttccag
gatcaatttgatgtgattctgataaatgaccggctcgaaacggcccttgccaaagccgaa
gaacttgtcgagaactttctcggctga

DBGET integrated database retrieval system