KEGG   Runella slithyformis: Runsl_1089Help
Entry
Runsl_1089        CDS       T01553                                 

Definition
xylulokinase
Orthology
K00854  
xylulokinase [EC:2.7.1.17]
Organism
rsi  Runella slithyformis
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rsi00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1271045..1272520
Genome map
AA seq 491 aa AA seqDB search
MKYLLGYDVGSSSVKVALLDIETGKALATGTSPDQEMGMIAHEPGWAEQHPDSWWQEAVN
ATHKLKAKYPFDPALVAGIGISYQMHGLVVVDKDLRPLRPSIIWCDSRAVEIGNHAMDDL
GAEYSLHHLLNSPGNFTASKLKWVKDKEPQIFEQIRYFMLPGDYLALRMSGTPQTTVSGL
SEGIFWDFAEQKVSQKLLDLYGFDSALIPQIVDTFSPQSQLSASAAAELGLKAGIPIAYR
AGDQPNNAFSLNVLNPGEVATTAGTSGVVYGINAQATSDPLSRVNTFAHVNSTPEEQRNG
VLLCVNGTGILNSWVRRFAGGLSYDEMNRQAAHTPIGAEGLTFLPFGNGAERVLENRLLG
GQLQGINFNRHTPAHVFRAAQEGIVFALQYGLQVMKEMGVQTHTVRAGHANLFLSPLFRE
AFANTTGATIELYDTDGAQGAARAAGIGTGVFDTKSAFNGLTQIATVEPLADLQEKYANT
YAVWEDALKKI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaaataccttttaggctacgacgtaggcagctcgtccgtaaaagttgctttgttggat
atagaaacgggcaaagccctcgccacgggtacctcgcccgatcaggaaatgggaatgatt
gcccacgaaccgggctgggccgaacagcaccccgacagttggtggcaggaagccgtcaac
gccacgcataagttaaaagccaagtacccgtttgatcccgcgctggtggccggtatcggt
atttcgtaccaaatgcacggattggtggtggtcgacaaagacctgcgcccgctgcgccct
tccatcatctggtgcgatagccgcgccgtggagatcggcaaccacgccatggacgatctc
ggtgcagaatacagcctgcatcatctgcttaactctccgggcaattttacggcgtcaaaa
ctcaaatgggtcaaagacaaagaaccgcagatttttgagcagattcggtatttcatgttg
cccggcgattacctcgccctgcgcatgtcgggtacccctcaaaccaccgtttcgggactt
tcggaagggattttctgggattttgcggaacagaaagtctcgcagaagctccttgattta
tacggttttgattcggccctgataccgcaaatcgtggatacgttttctccccaaagtcag
ctttcggcttcggcggcggctgaattgggcctcaaagcgggaatccccattgcctaccgc
gccggcgaccagcccaacaatgccttctcgctcaatgtactgaatccgggcgaagtagcc
actacggcgggcacctcgggcgtagtatatggtatcaacgcacaggccacttcagatccg
ctctctcgggtgaataccttcgcgcacgtcaacagcaccccggaagaacagcgcaacggc
gtgttgctgtgcgtcaacggaacgggaattctcaacagttgggtgcgtcgttttgcaggc
ggcctttcatacgatgaaatgaaccgacaggccgcacatacgcccatcggtgccgaagga
ctcacatttctgccctttggcaacggagccgagcgcgtgctcgaaaaccggttattgggc
ggtcagttgcaaggcatcaacttcaataggcacacgccggcgcacgtgttcagagcggcg
caggagggtattgtgtttgcgcttcagtacggtttgcaggtgatgaaagaaatgggcgta
caaacccacaccgtacgggccggccacgccaatttattcctgagtccactcttccgcgaa
gcttttgccaacaccaccggcgctaccatcgagctgtacgataccgacggcgcgcaggga
gctgcacgggcggcgggtattggtaccggggtttttgataccaaatcagccttcaacggc
ttgacgcagatcgccacggtggagcctttggccgatttgcaggaaaaatacgccaacact
tacgccgtttgggaagatgcgttgaaaaaaatatag

DBGET integrated database retrieval system